KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_5768Help
Entry
Mesci_5768        CDS       T01401                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00473  D-Alanine metabolism
mci00550  Peptidoglycan biosynthesis
mci01100  Metabolic pathways
mci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesci_5768
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesci_5768
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mesci_5768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mci01011]
    Mesci_5768
Enzymes [BR:mci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mesci_5768
Peptidoglycan biosynthesis and degradation proteins [BR:mci01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesci_5768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 TTL RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 10121268
NCBI-ProteinID: YP_004144867
UniProt: E8THQ5
LinkDB All DBs
Position
complement(5966982..5968004)
Genome map
AA seq 340 aa AA seqDB search
MRVAVVSNHDHTGVINRFGQPIPEFGDREEVESVVAALQEGGHETLICDGDKGLLATLER
FMPPDRQSRPSGIVFNLAWGSQGERPEAGVPAMLEMAGVPCTGPGPLGYGLAFDKVIIKR
LIRDRGVPTPNFRVMRLGTETTGDLRFPLVVKPRYECASFGLQLAHEPAQLRQAVEVIVT
LYAQDALVEEYIDGREITVALLGNRELEVLPLVEYDFRDREKRCLTREAKQRRICPGQIG
SRLATVLQDISVATFLECQCRDYARVDLRIDRSGQAFVLEINNMPSLRMRASYVLAARTA
GYTFSSLVNRILDVAHMRYFGIGIPNAEHASNRGRRIGSS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtagcagtcgtatcgaaccatgatcatacaggtgtgatcaaccggttcgggcag
cctattccggagttcggcgaccgcgaagaggtggaaagcgtggtggcggcgctgcaagag
ggaggtcacgagacgctgatttgcgacggcgacaaaggactgctcgctacgctcgagcgg
ttcatgccccccgatcggcaatcccggccctcggggatcgtcttcaacttggcgtgggga
agtcagggcgagcgccctgaagccggcgttccggccatgcttgagatggcaggcgtgccg
tgtaccggaccgggcccgcttggatatggtctggcgttcgacaaggtcatcatcaagagg
ctcatccgcgatcgcggagtgccgacgccaaattttcgggtgatgcgtctcggcaccgag
actaccggcgacctgcgattcccattggtagtgaagccgcgttacgaatgcgcgagcttc
gggttacagctggcacatgagcccgctcagttgaggcaggccgtggaggtgatcgtaacg
ctgtatgctcaggacgcactcgtcgaagaatacattgatgggcgagaaatcactgtcgcg
ctgcttggaaatcgagagctcgaggtgttaccccttgtggaatacgacttccgcgaccgc
gaaaagcgttgtctgactcgggaagctaagcagcggagaatttgcccggggcaaatcggg
agtaggcttgcgactgtgctgcaagatatttcggttgcgacgttccttgagtgccagtgc
cgggactacgcccgcgtcgacctacggatcgaccgctccggccaggcctttgtcctcgag
atcaacaacatgccgtcactccgtatgcgcgcctcttatgttctggcagcgaggaccgcc
ggatacaccttctcgagtttggtaaatcgcatccttgatgttgcgcacatgcggtatttc
ggaatcggcatccccaacgccgaacacgcgtcgaatcgcggccggaggatcggaagttcc
tga

DBGET integrated database retrieval system