KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_5990Help
Entry
Mesci_5990        CDS       T01401                                 

Definition
(RefSeq) phosphate transport system regulatory protein PhoU
  KO
K02039  phosphate transport system protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mesci_5990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoU DUF489
Motif
Other DBs
NCBI-GeneID: 10121492
NCBI-ProteinID: YP_004145047
UniProt: E8TKT3
LinkDB All DBs
Position
complement(6206999..6207724)
Genome map
AA seq 241 aa AA seqDB search
MQSVHIVSAYDEELKYLSKRIAAMGGHAERMVEQAVTALVNADPGLAQKVIRDDTVLDEG
QREIDDKAIIIIAKRQPMAADLREIVGTIRISADLERVGDLAKNVAKRVVAVTDGRQPTS
LFRGLEALSNLALTQLKEVLDVYASRSVEKIGFVRDRDDQIDAMYTSLFRELLTYMMEDP
RNITPCTHLLFCAKNIERIGDHATNIAETIYYIVTGDQLPAERPKGDKTDKISLSETQPV
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccgtgcacatcgtcagcgcttatgacgaggagttgaaatatctgtcgaagcgc
atcgccgcgatgggtggccatgccgagcgcatggtcgaacaggcggtcaccgctctcgtc
aatgccgacccgggccttgcccagaaggtcatccgcgacgataccgtactggacgagggc
cagcgcgaaatcgacgacaaggcgatcatcatcattgccaagcgtcagccgatggcggcg
gatttgcgcgagatcgtcgggaccatccgcatctccgccgacctcgaacgggttggcgat
ctcgccaagaacgttgccaagcgggtggtcgccgtcaccgacggacgccagccgaccagc
ctgttccgcggcctcgaggccctctccaacctggcgttgacccagctcaaggaagtgctc
gacgtctacgcgtcccgttcggtggagaaaatcggcttcgtgcgcgatcgtgacgaccag
atcgacgccatgtacacatcgctgtttcgcgaattgctgacctacatgatggaagatccg
cgcaacatcacgccctgcacgcatctgctgttttgcgccaagaacatcgagcgtatcggt
gatcacgccaccaacatagccgagaccatctactacatcgtcaccggcgatcagttgccg
gctgagcggcccaagggcgacaagaccgacaaaatcagcctttccgagacgcagccggtg
aagtga

DBGET integrated database retrieval system