KEGG   Methanothrix soehngenii: MCON_1074Help
Entry
MCON_1074         CDS       T01468                                 

Gene name
mtrD
Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00680  Methane metabolism
mcj01100  Metabolic pathways
mcj01120  Microbial metabolism in diverse environments
mcj01200  Carbon metabolism
Module
mcj_M00357  Methanogenesis, acetate => methane
mcj_M00567  Methanogenesis, CO2 => methane
mcj_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mcj00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MCON_1074 (mtrD)
Enzymes [BR:mcj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MCON_1074 (mtrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: AEB67815
UniProt: F4BZJ5
LinkDB All DBs
Position
complement(921490..922179)
Genome map
AA seq 229 aa AA seqDB search
MIFDATTIVYILEIVVGGLLVGVGVHFVPVGGAPAAMAQATGIGTGTVQLAAGSGLTGLL
AAGLMMSVTDNIWLVLASGAVGAGIMVGSTMLTGSWIYAYAVGVPFVSAKVTYDPITGFS
QPPYIAPGTVGHGIPTVCFVSGLIGGMMGGLGGAMIYYALYLINGNAALSAMFAIGIFMV
NAVIASWNIQGTIEGFHDPKFKKWPFAFRACLIASVLLALASVLITGGA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgatgcaactaccattgtatacatcctggagatcgtcgtgggagggcttctg
gtaggcgtcggcgttcacttcgtccctgtgggcggtgcacctgcggccatggcccaggct
accggcatcggtacgggaactgtgcagctggcagccggatcgggtctcactggcctcttg
gctgcgggcctgatgatgtcggtcacagataacatctggctcgtcttagcttctggagct
gtcggcgcaggaattatggtgggctccaccatgcttactggctcctggatatacgcttat
gcagtaggagtgccctttgtctcggccaaggtgacatatgatcccataaccggattctcc
cagccgccttatatcgcaccgggaacagtcggccatggtatacccacggtctgctttgtc
agcggcctaatcggcggcatgatggggggtcttggcggagccatgatctactatgcactc
tatttgatcaacggcaatgccgctttgagcgccatgttcgccattggtattttcatggtg
aacgctgtgattgcctcctggaacatccagggtacaatcgagggcttccatgatccgaag
ttcaagaaatggcccttcgcattcagagcctgtctcatcgccagcgtactgctcgcttta
gcatcagtattgatcaccggaggtgcctag

DBGET integrated database retrieval system