KEGG   Methanothrix soehngenii: MCON_2015Help
Entry
MCON_2015         CDS       T01468                                 

Definition
(GenBank) conserved hypothetical protein TIGR01209
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mcj  Methanothrix soehngenii
Brite
KEGG Orthology (KO) [BR:mcj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCON_2015
Enzymes [BR:mcj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MCON_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase LysM
Motif
Other DBs
NCBI-ProteinID: AEB68571
UniProt: F4BWT5
LinkDB All DBs
Position
complement(1715535..1716656)
Genome map
AA seq 373 aa AA seqDB search
MNLQRIADKLGITVDRLQSLQDTKISESSWPEPQLLRFDKEISGVEAGTVIFKNGEIVWG
YPSIRRPLMLEAGIKRHFIDSVAVEEKMNGHNVRITSIDGDIVALTRGGFVCPYSTEVAT
RLLPEDIFEEKPNLVLCAEMVGPENPYVSLDVYPTDSIDLYLFDVAQKNQRGTHGVHKTH
EIAEDFGLKGTAFFGEFPRETAHKRIKEIVIKLGRQGREGVVLKDPENRVAPLKYTSSES
NCNDLAIAFSHYNDYALDFFLSRAVREGFQSVEWQESVEERRERARRIGESILLPLTETI
KNKQQGETIMQRIKIRVKSLATARGFEYHLRRCGIRAIFDQPLPDDDGYTIGITKIIMST
NDKTEALLNGEMW
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcaaaggattgcagataaactgggaataactgtagatcggctgcaaagcctg
caagatacgaagatatctgaatcaagctggcctgagcctcaactgctgagatttgataag
gagatctcaggggttgaggccgggacggtgatttttaaaaacggagaaattgtctggggc
taccccagcatccgccgtcctctgatgcttgaagcggggataaaacgtcattttatcgat
tctgtggcagtggaggagaagatgaatggccacaatgtccgcataacatccatagacggg
gatatcgtggccctgaccagaggtggttttgtctgcccttactccacagaggtggcgaca
aggctcctgccggaggatattttcgaagagaagcccaatctggtcctttgcgcggagatg
gtgggcccggagaacccctatgtatctttagatgtctatcccactgacagcatcgattta
tacctcttcgatgttgcccaaaagaaccagcgagggacccatggggtgcataagacccac
gagatagcagaggatttcggcctgaaagggaccgctttttttggagaatttccccgggag
acggcgcacaaaaggatcaaagagatagtgatcaagctgggccggcaaggaagggagggg
gtggtcttgaaggacccggaaaacagggtagcccctctgaaatataccagctccgaatcg
aactgcaatgacctggcaatagcttttagccactataacgactatgctcttgacttcttt
ttatcccgcgcggtccgggagggctttcaatcagtggaatggcaggagtcggtggaggag
agaagggagagggcccggcgcattggtgagagcattctcttgcccctgacagagaccatc
aagaataagcagcagggggagactattatgcagagaattaagatccgggtgaaaagcctg
gccacagcccggggatttgagtatcacctgcgcagatgcgggatccgggcaatattcgac
cagccgctgcctgatgatgacggctataccataggaatcaccaaaataatcatgagcaca
aatgataagactgaagccctcttgaatggagagatgtggtga

DBGET integrated database retrieval system