KEGG   Mycoplasma canis PG 14: AXW82_01975Help
Entry
AXW82_01975       CDS       T04557                                 

Gene name
gyrB
Definition
(GenBank) DNA topoisomerase IV subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
mck  Mycoplasma canis PG 14
Brite
KEGG Orthology (KO) [BR:mck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mck03032]
    AXW82_01975 (gyrB)
   03400 DNA repair and recombination proteins [BR:mck03400]
    AXW82_01975 (gyrB)
Enzymes [BR:mck01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     AXW82_01975 (gyrB)
DNA replication proteins [BR:mck03032]
 Prokaryotic type
  DNA Topoisomerases
   AXW82_01975 (gyrB)
DNA repair and recombination proteins [BR:mck03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      AXW82_01975 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 TOPRIM_C
Motif
Other DBs
NCBI-ProteinID: AMD81313
LinkDB All DBs
Position
513254..515200
Genome map
AA seq 648 aa AA seqDB search
MSEKQHSYDASNITFLEGLEHVRKRPGMYIGSTSKSGLHHMVWEIVDNSVDEAMAGFANK
IEITITENNEIIVEDNGRGIPVGTHAKFGISALEVVLTKLNAGGKFESDAYKVSGGLHGV
GASVVNALSQSMKAWVKRDGNIYHAEFHNGGKTLKSTEIIGSYTEGGSGTKIQFLPDYTI
MEKMPFDKELIADHAKQIAYLNKGLFVSVRDLRDNTYSEFKYENGIVDYVTELNKGSLPI
NNIIYASGNYSYKHDITGKDVVIGVEVAAQYLNDFYRSNLITYTNNISTHEGGTHLTGFY
DAIMRLVNNYAIEKSFIKNENDKFTRDDLIEGLVAVISIKHPEPQFEGQTKGKLGSKDAR
KAVNEVYSEIFERFLNENPEVAKKIIEKAISARRSRIASNAARDNERKKLPFESGSMPGK
LAPCSSKNAEICELFIVEGQSAGGSAKMGRDKVFQAILPLKGKILNTEKAKRDKIFMNEE
IMSLINAMGAGLEESFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFKPLIEYGFI
YIAQPPLYKIQQNKNVLYAFNEKEKDEILSNLNPNTKITIQRYKGLGEMDAQQLKETTMM
PEKRKMLQVQIEDAYRADRIFETLMGDNVEPRKEFISNNAKYVKNIDL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaacaacacagctatgatgcatctaatattacttttttagaaggattagaa
cacgttagaaaacgtcctggaatgtacattggttctacatcaaaatcaggattgcatcac
atggtctgagaaattgtggataactcagtggatgaagcaatggcaggttttgcaaataaa
atagaaataacaataacagaaaataatgaaatcattgtagaagataatggtagaggtatt
cctgttggaacacacgctaaatttggtattagtgcacttgaagttgtattaactaaatta
aatgcaggtggtaaatttgaatccgatgcttataaagttagtggtggtttacacggggtt
ggtgctagtgttgtaaacgctttaagccaatcaatgaaagcttgagtaaaaagagatggt
aatatttatcacgctgaattccataacggtggtaaaacattaaaatcaacggaaattata
ggatcatacacagagggtggatcaggtacaaaaattcaatttttaccagattatacaata
atggaaaaaatgccgtttgataaggaattaattgccgaccatgctaaacaaatagcttac
cttaacaaaggtttatttgttagcgtaagagacttaagagataatacatatagtgaattt
aaatacgaaaatggtattgtagactatgtaacagaattgaataaaggatctttaccaatc
aataacattatttatgcaagtggaaattactcttacaagcatgacataacagggaaagat
gttgttattggtgttgaagtcgcagcacagtatctaaatgacttttatagatcgaactta
atcacttacacaaacaacatatcgacacatgaaggtggaacacacctaactggattttat
gacgcaataatgcgtttagttaataattatgcaattgaaaaaagttttataaaaaatgaa
aatgataaattcactagagatgacttaattgagggtttagttgctgttatttctattaaa
caccctgaaccacaatttgaaggacaaacaaaaggaaaattaggttctaaagacgcaaga
aaggctgttaatgaagtttattcagaaatatttgaaagatttcttaacgaaaaccctgaa
gtagctaaaaagattatagaaaaagctatttcagcaagaagaagtagaatagcatcaaac
gcagcaagagataatgaacgcaagaaactaccttttgaaagtggatcaatgcccggaaaa
ttagctccttgttcatcaaaaaatgctgaaatttgtgagttatttatagttgaagggcaa
tcagctggtggttcagctaaaatggggagagataaagtctttcaagctattttgccttta
aaaggaaaaattttaaataccgaaaaagcaaaacgtgataagatctttatgaatgaagaa
ataatgtctctaattaacgctatgggtgctggtttagaagagtcattcaatattaataaa
ttaagatatcataaaattattataatgactgatgctgacgttgatggagcacacattaga
actcttttattaacgttcttttatagatattttaaaccattaatagagtatggatttatt
tatattgcccaacctccgctttataaaattcaacaaaacaaaaatgttttatatgcattc
aatgaaaaagaaaaagatgaaatattatcaaacctaaatcctaatacaaaaataacaata
caacgttataaagggcttggtgaaatggatgcacaacaattaaaagaaacaactatgatg
cctgaaaaaagaaaaatgttacaggttcaaatagaagatgcatacagggcagatagaata
ttcgaaacattgatgggtgataacgttgaaccaagaaaagaatttatttcaaacaacgct
aaatacgttaaaaatattgatttataa

DBGET integrated database retrieval system