KEGG   Macrococcus caseolyticus: MCCL_0099Help
Entry
MCCL_0099         CDS       T00848                                 

Definition
(GenBank) alkyl hydroperoxide reductase (large subunit) and NADH dehydrogenase homolog
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mcl  Macrococcus caseolyticus
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCCL_0099
Enzymes [BR:mcl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MCCL_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like FAD_binding_2 K_oxygenase DAO AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin FAD_binding_3 FMO-like DUF421
Motif
Other DBs
NCBI-ProteinID: BAH16806
UniProt: B9E995
LinkDB All DBs
Position
101662..103185
Genome map
AA seq 507 aa AA seqDB search
MLDSSLKQQLSQYLELLEGEIILTASKGEDKTSQDMMALLNEISEMSDKISIKEAVLKRT
PSFTVARPEEEARVTFAGVPLGHEFTSLVLALLQVSGRAPKLDEAVINQIKKIDQPLNFE
TFVSLTCTKCPDVVQALNVMSVLNPNITHTMIDGAVFREESKDIMAVPSIFLDGEEFGSG
KMTVEEIVNQVGGGADASEFDAREPFDVLVIGGGPASAAASIYAARKGLRTGIVAERIGG
QVNDTAAIENFISVKETTGPEFAQNLVDHIKSYDIDVMNAVRVESIEKIDDMSYVTLENG
GKLSSKTLIISTGAKWRNMNVPGEAEYKNKGVAYCPHCDGPLFEGKRVAVVGGGNSGVEA
AIDLAGIVKHVTLLEFGEELRADKVLQDRLASLENAEIIKSAATKELTGTDKLQALTYVD
RTTNEEHTVDLEGVFVQIGLVPSTEFVGDLVERNNRGEIIVDRNGATNVPGIFAAGDCTD
QTYKQIIISMGAGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctagacagtagtttaaaacaacaattaagtcaataccttgagttacttgaaggtgag
attattttaacagcaagtaaaggtgaagataaaacttcacaggatatgatggcattatta
aatgaaattagtgaaatgtcggacaaaatatctattaaagaagcagtgcttaagagaaca
cctagcttcacagttgcgcgtcctgaagaggaggcacgtgttacttttgcaggtgtacca
ttaggtcatgaatttacatcattagtacttgctctactacaagtgagtggcagagctcca
aaacttgatgaagcggtaatcaatcaaattaaaaagattgatcagcctttaaattttgaa
acgtttgtaagtctaacttgtacgaagtgtcctgatgttgtccaggcattgaacgtaatg
tcggtgcttaatccaaatattactcatacaatgattgatggtgcagtattcagagaagaa
tctaaagatattatggcagtacctagtattttcttagatggtgaagagtttggcagtggc
aaaatgacggttgaagaaatcgttaatcaagttggtggaggcgctgatgcatcagaattt
gatgcaagagagcctttcgatgtccttgttattggtggagggcctgcaagtgcagcagct
tcaatatatgctgcacgtaaaggtttaagaactggtattgttgcagaacgtatcggtgga
caagtaaatgatactgctgcaattgaaaactttatttctgtaaaagaaacaacaggtccg
gagtttgctcagaacttagttgatcatattaaaagctatgacatcgatgtgatgaatgca
gtgcgtgtagaatcgattgagaaaattgatgatatgagttatgtcacacttgagaacggt
ggaaagctttcaagtaaaacattgattattagtacaggtgcaaaatggcgtaatatgaac
gtgccaggtgaagctgaatataaaaataaaggtgtagcttattgcccgcattgtgatggt
cctttatttgagggtaaacgtgttgcagttgttggtggcggaaactctggtgtagaggct
gcgattgatttagcgggtattgtaaagcatgtcactttacttgaatttggtgaagaatta
agagctgataaagtattacaggaccgtcttgcttcgttagaaaatgcagagataattaaa
tctgcagctacgaaagagttgacaggtacagataaacttcaagccttgacttatgtagat
cgtacgacaaatgaagaacatacagttgatttagaaggtgtcttcgtgcaaattggttta
gtaccaagtactgaatttgtgggagatttagtagagcgcaacaaccgtggtgaaattatc
gttgatcgtaatggtgctacgaatgttccaggtatatttgcagcaggagattgcacagat
caaacatataaacaaattattatttctatgggtgcaggtgcgacagcagcattaagcgca
ttcgactatttaattagaaattaa

DBGET integrated database retrieval system