KEGG   Macrococcus caseolyticus: MCCL_1861Help
Entry
MCCL_1861         CDS       T00848                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mcl  Macrococcus caseolyticus
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mcl03012]
    MCCL_1861 (tufA)
   03029 Mitochondrial biogenesis [BR:mcl03029]
    MCCL_1861 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcl04147]
    MCCL_1861 (tufA)
Translation factors [BR:mcl03012]
 Eukaryotic Type
  Elongation factors
   MCCL_1861 (tufA)
 Prokaryotic Type
   MCCL_1861 (tufA)
Mitochondrial biogenesis [BR:mcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MCCL_1861 (tufA)
Exosome [BR:mcl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MCCL_1861 (tufA)
  Exosomal proteins of breast cancer cells
   MCCL_1861 (tufA)
  Exosomal proteins of colorectal cancer cells
   MCCL_1861 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase Septin
Motif
Other DBs
NCBI-ProteinID: BAH18568
UniProt: B9E8Q0
LinkDB All DBs
Position
complement(1994087..1995274)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLSKKLGGEARSYDQIDNAPEEKERG
ITINTSHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GVEEYEDKIMELMDAVDEYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
EEVEIIGLTEEPSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREDVQRGQVLAKPGSI
TPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNIEM
NVELISPIAIEDGTRFSIREGGRTVGSGVVSVIEK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgatcgctcgaaaacacatgccaatattggtacaatcggtcac
gttgaccacggtaaaactactttaacagctgctatcgcaactgttttatcaaaaaaatta
ggtggagaagctcgttcttacgaccaaatcgataacgcacctgaagaaaaagaacgtggt
atcacaatcaatacttcacacatcgagtatgaaactgaaaaacgtcactatgctcacgtt
gactgcccaggtcacgcggactacgttaaaaacatgattactggtgctgctcaaatggac
ggtggtatcttagtagtatctgctgctgacggtccaatgccacaaactcgtgaacatatc
cttttatcacgtaacgttggtgtaccagcattagtagtattcttaaacaaagttgacatg
gttgacgatgaagaattattagaattagttgaaatggaagttcgtgacttattatctgaa
tatgacttccctggtgacgatgtacctgtaatcgctggatctgctttaaaagcattagaa
ggcgttgaagagtacgaagacaaaatcatggaattaatggacgcagttgatgagtacatc
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtacagttgcaactggacgtgttgagcgtggacaagttaaagttggt
gaagaagttgaaatcattggtttaactgaagaaccatcaaaaactacagttacaggtgta
gaaatgttccgtaaattattagattacgctgaagctggagataacatcggtgctttatta
cgtggtgtttctcgtgaagacgtacaacgtggacaagtattagctaaaccaggttcaatt
actccacatactaaattcaaagctgaagtttacgtattatctaaagaagaaggtggacgt
catactccattcttcactaactaccgccctcagttctacttccgtacaactgacgtaact
ggtgtagttaacttaccagaaggtactgaaatggtaatgcctggagataacatcgaaatg
aacgttgaattaatttctccaatcgcgattgaagacggaactcgtttctcaattcgtgaa
ggtggacgtactgtaggatcaggcgttgtatctgtaatcgaaaaataa

DBGET integrated database retrieval system