KEGG   Metallosphaera cuprina: Mcup_1923Help
Entry
Mcup_1923         CDS       T01467                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn03030  DNA replication
mcn03410  Base excision repair
mcn03420  Nucleotide excision repair
mcn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mcup_1923
   03410 Base excision repair
    Mcup_1923
   03420 Nucleotide excision repair
    Mcup_1923
   03430 Mismatch repair
    Mcup_1923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcn03032]
    Mcup_1923
   03400 DNA repair and recombination proteins [BR:mcn03400]
    Mcup_1923
Enzymes [BR:mcn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mcup_1923
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mcup_1923
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mcup_1923
DNA replication proteins [BR:mcn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mcup_1923
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mcup_1923
DNA repair and recombination proteins [BR:mcn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mcup_1923
   NER (nucleotide excision repair)
    Other NER factors
     Mcup_1923
   MMR (mismatch exicision repair)
    Other MMR factors
     Mcup_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Spore_Cse60 BBS2_N PHA_synth_III_E
Motif
Other DBs
NCBI-ProteinID: AEB96025
UniProt: F4G1D8
LinkDB All DBs
Position
1747055..1748851
Genome map
AA seq 598 aa AA seqDB search
MKFKLIAEYFDKLEKISSRIQLTSLLSDLFKNTDKNTISKVVYIIQGRLWPDFAGMPEIG
MGEKFLIKSIAMAFSKKEEEIEKIYKRIGDLGEVAYTLKNESKSSNILSFINNTTHDSEL
EVEEVYEDLVKIATSSGEGSRDVKIRTFAGILRKATPLEAKYLVRFVEGRLRLGIGDATV
LDALAITFGGSTEYRPIVERAYNLRADLGEIAKIIDAYGIEKLKTISPTPGIPIRPMLAE
RLADPAEIMEKVNGNALVDYKYDGERAQIHKKGEDIYIFSRRMENITNQYIDVVDYVKKF
INGDNFIIEGEIVPIDPESGEMRPFQELMHRRRKNDIYQAINEYPVSLFLFDLMLLNGQD
YTTRPLLDRRAALESIIKENDKVRIASHIMVNDVNKLKEYFYQAVADGAEGVMIKSVSPD
SVYKAGSRGWLWIKLKRDYQSEMADTVDLVVVGAFYGKGKRGGKFSSLLMAAYNPEKDVF
ETVCKVASGFSDQELDELQKKIEQLKRDEKHPRVISNMSPDVWVSPAIVAEIIGAEITIS
PLHTCCKNDKAGLSIRFPRFVRWRDDKSPEDATTNQEIMEMYSRQLKKIEDKPVDENI
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaagcttatcgctgaatattttgacaaattggagaaaatatcttctagaatt
cagctgacatctctgttgtccgatctcttcaagaacacagacaagaacacaataagtaag
gtcgtctacatcattcagggtagactctggccggactttgcaggaatgccagaaataggc
atgggtgaaaagttcctgattaaatcaattgctatggcatttagcaaaaaagaggaagaa
attgagaaaatctacaaaagaataggagatttaggagaagttgcctataccttaaaaaac
gaatcaaagtctagtaacatattatcatttattaacaatacaacacatgattccgaacta
gaagtggaggaggtttatgaggacttagtcaaaatagctaccagctccggagaagggagt
agagacgttaaaataaggactttcgctggaatcctacgtaaggccactcctttggaggct
aaataccttgttagattcgtagagggaagacttaggcttggaataggcgatgctacagtc
ctagatgccctagctataacttttggagggtctactgaatatagaccaatagtagagaga
gcctataatttgagagctgacctaggggagatagctaagattatagacgcttacgggata
gagaaactaaaaactatatctccgacgcctggaataccaataagacccatgctggcagaa
aggctagctgatccggcagagatcatggagaaggtgaatggaaacgctttggtcgactat
aaatatgacggagaaagagcacaaattcataagaaaggtgaggatatatatatattctct
aggagaatggaaaatataactaaccaatacatagatgtagtggattatgtgaaaaaattc
ataaatggagataatttcatcatagaaggtgaaatagtacctatagacccggagagtgga
gagatgagaccttttcaggagctcatgcatcgtagaaggaaaaatgatatctatcaagcc
ataaatgagtatccagttagtctcttcctcttcgatttaatgttattaaacggacaagat
tacacaacaaggcctctcctagatagaagggctgccttagaatcaataattaaagagaat
gataaggtccgaatagcttctcacattatggtgaatgatgtgaataagttaaaggagtac
ttttatcaagccgtagccgatggagctgaaggagtaatgataaagtccgtttcacctgat
tccgtatataaggctggatctaggggatggctatggattaaattaaaaagagattatcag
agcgagatggccgatactgttgacctagttgttgtgggagctttctatggaaaagggaag
agaggggggaaatttagttctttactaatggccgcgtacaatcccgagaaagacgtattc
gagacagtatgtaaggtagcatctggatttagtgatcaagaacttgatgaattacagaaa
aagatagaacaactgaaaagagacgaaaaacatcccagggtcatctccaatatgtctcca
gacgtttgggtatctcctgccattgtggctgagataattggagcagaaataaccatctca
ccgttgcatacatgctgcaagaacgataaggctggcctatccataagatttcctaggttc
gtaagatggagagatgataagagccctgaggatgcgacgacaaaccaagaaatcatggag
atgtattctagacagctcaaaaagatcgaggataaaccagtagatgaaaatatctag

DBGET integrated database retrieval system