KEGG   Mycobacterium canettii CIPT 140060008: BN44_10692Help
Entry
BN44_10692        CDS       T02419                                 

Gene name
echA
Definition
(GenBank) Probable Enoyl-CoA hydratase EchA3 (Enoyl Hydrase) (Unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00071  Fatty acid degradation
mcq00280  Valine, leucine and isoleucine degradation
mcq00281  Geraniol degradation
mcq00310  Lysine degradation
mcq00360  Phenylalanine metabolism
mcq00362  Benzoate degradation
mcq00380  Tryptophan metabolism
mcq00410  beta-Alanine metabolism
mcq00627  Aminobenzoate degradation
mcq00640  Propanoate metabolism
mcq00650  Butanoate metabolism
mcq00903  Limonene and pinene degradation
mcq00930  Caprolactam degradation
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
mcq01130  Biosynthesis of antibiotics
mcq01212  Fatty acid metabolism
Module
mcq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN44_10692 (echA)
   00650 Butanoate metabolism
    BN44_10692 (echA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN44_10692 (echA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN44_10692 (echA)
   00310 Lysine degradation
    BN44_10692 (echA)
   00360 Phenylalanine metabolism
    BN44_10692 (echA)
   00380 Tryptophan metabolism
    BN44_10692 (echA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN44_10692 (echA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN44_10692 (echA)
   00281 Geraniol degradation
    BN44_10692 (echA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN44_10692 (echA)
   00627 Aminobenzoate degradation
    BN44_10692 (echA)
   00930 Caprolactam degradation
    BN44_10692 (echA)
Enzymes [BR:mcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN44_10692 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CCK50549
LinkDB All DBs
Position
complement(730175..730870)
Genome map
AA seq 231 aa AA seqDB search
MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSG
GFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVA
AHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIAL
PEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccggtcagctatacccgcaaggattccatcgccgtcatcagtatggacgac
ggcaaggtcaacgcactgggcccggcgatgcaacaagccctcaatgcagcgatcgacaac
gcggaccgtgatgatgttggggcgctggtgatcaccggtaatggccgggtattcagcgga
ggcttcgacctgaagatcctcacctccggtgaagtgcagcccgcgatcgacatgctcagg
ggcggcttcgagctggcgtatcgcctcttgtcctaccccaaaccggtggtgatggcgtgc
accggtcacgccatcgccatgggcgcgtttctgttgtcctgcggcgatcatcgggtggcg
gcccacgcatacaacatccaggccaatgaggtcgcgatcggcatgaccattccgtacgcg
gcgttagagatcatgaagctgcgactgacccggtcggcataccagcaggcaaccgggctg
gccaagacgttcttcggggaaaccgcgctggccgccgggtttatcgacgagatcgccctg
ccggaggtggtggtcagccgcgccgaggaagccgcacgagagttcgccggtctcaaccaa
cacgcccatgccgcgaccaagttgcgctcccgcgccgacgcgctcactgcgattcgggcc
gggatcgacgggatagcagccgagttcgggctgtaa

DBGET integrated database retrieval system