KEGG   Mycobacterium canettii CIPT 140060008: BN44_20182Help
Entry
BN44_20182        CDS       T02419                                 

Gene name
cya
Definition
(GenBank) Membrane-anchored adenylyl cyclase Cya (ATP pyrophosphate-lyase) (adenylate cyclase)
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00230  Purine metabolism
mcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN44_20182 (cya)
Enzymes [BR:mcq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     BN44_20182 (cya)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HNOBA RVT_3
Motif
Other DBs
NCBI-ProteinID: CCK51555
LinkDB All DBs
Position
complement(1827375..1828706)
Genome map
AA seq 443 aa AA seqDB search
MAARKCGAPPIAADGSTRRPDCVTAVRTQARAPTQHYAESVARRQRVLTITAWLAVVVTG
SFALMQLATGAGGWYIALINVFTAVTFAIVPLLHRFGGLVAPLTFIGTAYVAIFAIGWDV
GTDAGAQFFFLVAAALVVLLVGIEHTALAVGLAAVAAGLVIALEFLVPPDTGLQPPWAMS
VSFVLTTVSACGVAVATVWFALRDTARAEAVMEAEHDRSEALLANMLPASIAERLKEPER
NIIADKYDEASVLFADIVGFTERASSTAPADLVRFLDRLYSAFDELVDQHGLEKIKVSGD
SYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRGNPVPLRVGLATGPVVAGVVGSR
RFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGKGVMRTWY
LIGRKVAADPGEVRGAEPRTAGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcaagaaaatgcggcgccccaccgatagcagcggatggctcgacacgacgccca
gactgtgtcacggccgtgcgcactcaggcccgcgctcccacgcagcactacgccgaaagc
gtcgcgcggcggcagcgcgtgcttaccatcaccgcctggctcgctgtcgtggtaaccggg
agcttcgcgctaatgcaactagcgaccggggccgggggctggtacatcgccctgatcaac
gtcttcaccgcggttactttcgcgatcgtgcccctgctacatcgcttcgggggattggtg
gcaccgcttacgttcatcggcaccgcctatgtggcgatcttcgccatcggctgggatgtg
ggcaccgacgcgggtgcccagttcttcttcttggtagccgccgcgttggtggtgttgctg
gtcggcatcgaacacaccgcgttagcggtgggcctagcggcggtcgccgccggtctggtg
attgccctggagttcctggtcccgcccgatactgggcttcagccgccctgggccatgtcg
gtaagtttcgtcctcacgaccgtctccgcctgcggggtagcggtcgcaacggtgtggttc
gcgctgcgtgatactgcgcgcgcggaggcggtcatggaggcggagcacgaccgctccgaa
gcactgctggccaacatgttgccggccagcatcgccgagcggcttaaagaacccgagcga
aacatcatcgccgataaatacgacgaggcctcggtgctgttcgccgacatcgtcgggttc
accgaacgcgccagtagcaccgcgccggcggacctggtccggttcctggaccgcctctac
agcgctttcgacgagctggtcgaccagcacgggctggagaaaatcaaggtcagcggggac
tcctacatggttgtcagcggcgttccgcggccccggcctgaccatacgcaagcactggcg
gactttgcgctcgacatgaccaatgtcgcagcgcaattgaaggatccacgcggcaacccg
gtgccgctgcgggtgggcctggccaccggcccggtggtggcgggtgtggtgggttctcga
cggttcttctacgacgtgtggggcgacgcggtcaatgtcgcgtcgcggatggaatccacc
gattcggtggggcaaattcaggtgccagacgaggtttacgagcgtctcaaggacgacttc
gtgttgcgcgagcgcggccacataaacgtcaaggggaaaggcgtaatgcgcacgtggtac
ctcatcggccgcaaggtagccgcagatcccggcgaggtgcgcggggccgaaccccgcacg
gccggggtctga

DBGET integrated database retrieval system