KEGG   Mycobacterium canettii CIPT 140060008: BN44_80083Help
Entry
BN44_80083        CDS       T02419                                 

Gene name
alr
Definition
(GenBank) Alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00473  D-Alanine metabolism
mcq01100  Metabolic pathways
mcq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN44_80083 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN44_80083 (alr)
Enzymes [BR:mcq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BN44_80083 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mcq01011]
 Precursor biosynthesis
  Racemase
   BN44_80083 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCK53422
LinkDB All DBs
Position
complement(3867937..3869097)
Genome map
AA seq 386 aa AA seqDB search
MAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQLMAVVKADGYGHGATRVAQTAL
GAGAAELGVATVDEALALRGDGITAPVLAWLHPPGIDFGPALLADVQVAVSSLRQLDELL
DAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALRQAMAEDAVRLRGLMSHMVYADK
PDDSINNVQAQRFTAFLAQAREQGVRFEVAHLSNSSATMARPDLTFDLVRPGIAVYGLSP
VPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWIAPRDTNLALLPIGYADGVFRSL
GGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRGEPTAQDWADL
VGTIHYEVVTSPRGRITRTYREAENR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtggatctg
ggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcagctgatg
gcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaaccgccctg
ggcgccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctgcgcggt
gacggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttcgggccc
gcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaactgttg
gacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggataccgggctg
aaccgcaatggcgtgggacccgcacaattcccggccatgctgaccgcgttacgccaagcc
atggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgccgacaag
cctgacgattccatcaacaatgttcaggcccaacggtttaccgcctttctggcgcaggcc
cgcgaacaaggggtgcggttcgaggtggcgcatctgtcgaactcatcagcaactatggcg
cgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggctaagcccg
gtacccgccctcggcgacatggggctggtgccggcgatgaccgtgaaatgtgctgttgcg
ctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacctggatcgcgcca
cgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccggtcgctg
ggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcggatctgc
atggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggcgacgag
gcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggccgatctt
gtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccaggacctat
cgcgaggctgaaaaccgttga

DBGET integrated database retrieval system