KEGG   Moraxella catarrhalis 25240: DR90_1616Help
Entry
DR90_1616         CDS       T03217                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mcs  Moraxella catarrhalis 25240
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DR90_1616 (ahpF)
Enzymes [BR:mcs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DR90_1616 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO Thi4 FAD_binding_2 FAD_oxidored NAD_binding_7 AlaDh_PNT_C NAD_binding_8 NAD_binding_9 K_oxygenase FAD_binding_3 Glutaredoxin Lycopene_cycl 3HCDH_N DSBA
Motif
Other DBs
NCBI-ProteinID: AIK00541
UniProt: A0A3A9KWB4
LinkDB All DBs
Position
complement(1733848..1735404)
Genome map
AA seq 518 aa AA seqDB search
MLDQNLLDAVKSYSANMTRPIQLVIGAGEHEKRAELIDFLTKIAGTTDKIQFDAQVIDNR
LSPMSFKITTQNRDTGIVFSGIPGGHEFTSLILAILQAGGHALKLDEDIQQLVKHIQEPL
KFQTFVSLSCHNCPDVVQALNQFAILNDHIENEMIDGGVFPELVAEKKIQGVPAVFLNGK
PFANGKVDTAKLIEKLQEQYPNLLASANEVQLETQDVTVIGGGPAGTAAAIYTARKGLRV
AIVADRIGGQVKDTQDIENLISIPLTNGNTLAANLATHIKEYNITVKEHVSVSKLEEVDG
GYQVTLSTGASWLSRTVILATGAKWRKLGVKGEDENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGVEAALDLAGIVNHVTVLEFGDSLRADQVLIDKAEARENITIIKSAATTEITTDG
SKVNALIYQDRVSGNSQTLPLSAVFVQIGLVPNSEIAKGLVTMTPQGEIEIDAKCRTSKV
GIFACGDVTTVPYKQINIAMGEGSKAGLAAFEYLMMNG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaatttattagatgccgttaaatcctacagtgccaatatgactcgtcca
attcaattggtcattggtgcaggcgagcatgaaaagcgtgccgaattgattgatttttta
actaaaattgctggtacaactgataaaatccaatttgacgctcaagtgatcgataatcgt
ttatcaccgatgagctttaaaattaccacacaaaatcgtgatacaggtattgtatttagt
ggtattccaggcggtcatgaatttacttcattgattttggccatcttgcaggcaggtggg
catgcattgaagctggatgaagatatccagcagctggttaagcacattcaagagccacta
aaatttcaaacttttgtttccttatcttgccataattgccctgatgtggttcaagcactc
aatcagtttgcgattttaaatgaccatattgaaaatgagatgattgatggtggtgtattt
ccagaattggttgctgagaaaaaaatccaaggcgtaccagcggtatttttaaacggtaaa
ccttttgctaatggtaaggttgatactgccaaactgattgaaaaacttcaagagcagtat
ccaaatttattagcatcagcaaatgaagtccagcttgaaacacaagatgttacagtcatc
ggtggcggtccagcaggcacagcggcagcaatctatactgctcgtaaaggattgcgtgtt
gcaatcgtggcagatcgtatcggtggtcaggttaaagatacgcaagatatcgaaaactta
atttctattcctttgaccaatggtaatacattggctgcgaatttggcaacacacataaaa
gagtacaatattaccgtcaaagagcatgtcagcgtaagcaagcttgaggaggttgatggc
ggctatcaggtgactttaagcacgggtgccagctggctttctcgtactgtgattttggca
actggtgccaaatggcgtaagcttggtgttaagggtgaggatgaaaatattggtaatgga
gtcgcctattgcccacactgcgatggcccattttttaaaggtaaagatgttgcggtgatt
ggcggtggtaactcaggtgttgaggcggcgttggatttggcggggattgtcaatcatgtg
actgtcttggagtttggtgactcattgcgcgccgatcaagtgttaattgacaaagctgaa
gcacgagagaatatcacaattataaaatcagcagcaacgaccgaaatcactactgatggt
agtaaagtgaatgcgttgatttatcaagatagagtgagtggcaatagccaaacattgcca
ttatctgctgtttttgtccaaattggcttggtgccaaattcagagattgccaaaggcttg
gtaacaatgacgccgcaaggtgagattgaaattgacgccaaatgtcgcacaagtaaggtt
ggtatttttgcttgtggtgatgtgacaacagtgccatataagcagattaatattgccatg
ggtgagggttctaaagcaggattagcggcttttgagtatctgatgatgaatggctga

DBGET integrated database retrieval system