KEGG   Moraxella catarrhalis 25240: DR90_187Help
Entry
DR90_187          CDS       T03217                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
mcs  Moraxella catarrhalis 25240
Pathway
mcs00550  Peptidoglycan biosynthesis
mcs01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DR90_187
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DR90_187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mcs01011]
    DR90_187
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcs03036]
    DR90_187
Enzymes [BR:mcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DR90_187
Peptidoglycan biosynthesis and degradation proteins [BR:mcs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DR90_187
Chromosome and associated proteins [BR:mcs03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    DR90_187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Aida_N
Motif
Other DBs
NCBI-ProteinID: AIK00346
LinkDB All DBs
Position
211539..213497
Genome map
AA seq 652 aa AA seqDB search
MTKQRKNPKTGSATTAVSLHRPKASAKTFGILTKKRIKKSGANLAGGKQDAWRYLIIGGL
MLCIFMAIFARAFYLQIVNPQFFIDKGDELITGKRIEPAYRGVITDREGAPLAANAPLYT
VFFDPYAYAEEYYRLDNEIKTTKSETAKQKALKKLKEMDLVRLAAAANYPLEKLEAAVGI
DHTLDTSNSQKVKEALPKGASSRRLVLLNRVSPEVAKSVTDLGLFAIGREQYFQRYYLQA
EPNAQLLGYMAQSSDETQGGYIGRAGIEAKYNERLAGKDGKVQILRGTGRQPIQEIEQIE
PLIEGENIRLTIDSRLQYVLYKELEQVGRLQSARSSSGMVVDVKTGEVLAMGSWPSFNSN
NLSERDGANERNRPVLDVFEPGSVMKPFTVAAALESGKYTTNSVIDTSPGSMSVGGYTIR
DSGNYGVITLDKLIQKSSNVASTKIALNLPTDAIANMQLKFGFGRKTALDFPAEASGRVS
IPKERELARRATLSYGYGQQVTLAQLAQAYAALGNRGLMQPLKLVKDQKTPEPTQVIHAG
HAEAIVRMMELVTGPGGTGQAAAINGYRVAGKTGTSRRTNPQGGYYTDQHRAIFVGLAPA
SDPRFVVSILVEDPRRQSYAGQVSAPVFHQVMKEALRLYNVPYDKPLRVLAP
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaagaaaaaatccaaaaactggctcagcgacgacagcagtgtctttacac
cgtccaaaggcgtctgccaagacttttgggattttaaccaaaaaacgcatcaaaaaatct
ggcgctaatttggctggtggcaagcaagatgcttggcgatatttgatcattggggggttg
atgctgtgtatatttatggcgatttttgcacgcgcattttatctacagatcgtcaatccg
cagttttttattgataaaggtgatgagttgattacgggcaaacgcattgaacctgcgtat
cgaggtgtcatcacagatcgtgaaggtgcacctttggctgccaatgcaccattatatacg
gtattttttgatccttatgcctatgccgaagaatattatcgcttggacaatgaaataaaa
accaccaaaagtgaaaccgccaaacaaaaagcactcaaaaaactcaaagaaatggacttg
gttaggttggcagcggcggcaaattatccgcttgaaaaacttgaagcggctgttgggatt
gatcatacacttgacacctctaatagccaaaaagtcaaagaagctttaccaaaaggtgca
agctcacgccgtttggtgctattaaaccgtgtatcacctgaagttgccaaatccgtcaca
gatttggggttatttgccattggtcgtgagcagtattttcaacgctactatttacaagct
gaacccaatgcacagcttttgggttatatggctcagtcaagtgacgagactcaaggcggc
tatattgggcgtgcaggcattgaggctaaatataatgagcgtttggcgggcaaagatggc
aaggtacagattttgcgtggtactggtcggcagcccattcaagagattgagcaaattgaa
ccgcttattgaaggcgaaaacattcgcttaacaattgactcacgattgcagtatgtgctt
tataaagagcttgagcaggttgggcgtttgcagtcggcgcgttcaagctcaggcatggtg
gttgatgttaagacgggcgaagtgttggcgatggggtcatggccatcttttaattctaat
aatttgtccgaacgagatggtgctaacgaaagaaaccgccccgtgcttgatgtgtttgag
ccaggttcggtgatgaaaccgttcacagtggccgccgcacttgaatctggcaaatacacc
acaaattctgtgattgatacaagcccaggcagtatgtcggtaggtggatatacgatccga
gatagtggtaattatggcgtcatcacgctagataaactgatccaaaaatccagtaatgtt
gcctcaacaaaaattgcgttaaatttaccgactgatgccatcgctaatatgcagcttaaa
tttggctttggccgcaagacggcactggatttccctgctgaggcatcgggacgagttagc
attccaaaagagcgtgagctggcacgccgtgcaacactaagttatggctatggtcagcaa
gtgacattggcacagttggcccaagcttatgcagcacttggcaatcgggggctgatgcag
ccattaaaacttgttaaagatcaaaaaacgcccgaacctacccaagtcattcatgcaggt
catgccgaagccattgtgcgtatgatggagcttgtgacaggaccaggtggcacaggtcaa
gccgctgccatcaatggctaccgtgtggcgggtaaaacaggtaccagtcggcgtaccaat
ccacaaggtggttattataccgatcagcatcgtgcgatttttgtgggcttggcacctgcg
tcagatccacgctttgtggtgtcaattttggttgaagatccacgccgccaatcgtatgca
ggccaagtatcagcacccgtattccaccaagtgatgaaagaggcactgcgcttatataat
gtgccttatgataagcctttacgggttttagcaccctaa

DBGET integrated database retrieval system