KEGG   Moraxella catarrhalis BBH18: MCR_0291Help
Entry
MCR_0291          CDS       T01224                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mct  Moraxella catarrhalis BBH18
Brite
KEGG Orthology (KO) [BR:mct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCR_0291 (ahpF)
Enzymes [BR:mct01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MCR_0291 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO Thi4 FAD_binding_2 FAD_oxidored NAD_binding_7 AlaDh_PNT_C NAD_binding_8 NAD_binding_9 K_oxygenase FAD_binding_3 Glutaredoxin Lycopene_cycl 3HCDH_N DSBA
Motif
Other DBs
NCBI-ProteinID: ADG60563
UniProt: D5VA60
LinkDB All DBs
Position
304357..305916
Genome map
AA seq 519 aa AA seqDB search
MMLDQNLLDAVKSYSANMTRPIQLVIGAGEHEKRAELIDFLTKIAGTTDKIQFDAQVIDN
RLSPMSFKITTQNRDTGIVFSGIPGGHEFTSLILAILQAGGHALKLDEDIQQLVKHIQEP
LKFQTFVSLSCHNCPDVVQALNQFAILNDHIENEMIDGGVFPELVAEKKIQGVPAVFLNG
KPFANGKVDTAKLIEKLQEQYPNLLASANEVQLETQDVTVIGGGPAGTAAAIYTARKGLR
VAIVADRIGGQVKDTQDIENLISIPLTNGNTLAANLATHIKEYNITVKEHVSVSKLEEVD
GGYQVTLSTGASWLSRTVILATGAKWRKLGVKGEDENIGNGVAYCPHCDGPFFKGKDVAV
IGGGNSGVEAALDLAGIVNHVTVLEFGDSLRADQVLIDKAEARENITIIKSAATTEITTD
GSKVNALIYQDRVSGNSQTLPLSAVFVQIGLVPNSEIAKGLVTMTPQGEIEIDAKCRTSK
VGIFACGDVTTVPYKQINIAMGEGSKAGLAAFEYLMMNG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagaccaaaatttattagatgccgttaaatcctacagtgccaatatgactcgt
ccaattcaattggtcattggtgcaggcgagcatgaaaagcgtgccgaattgattgatttt
ttaactaaaattgctggtacaactgataaaatccaatttgacgctcaagtgatcgataat
cgtttatcaccgatgagctttaaaattaccacacaaaatcgtgatacaggtattgtattt
agtggtattccaggcggtcatgaatttacttcattgattttggccatcttgcaggcaggt
gggcatgcattgaagcttgatgaggatatccaacagctggttaagcacattcaagagcca
ctaaaatttcaaacttttgtttccttatcttgccataattgccctgatgtggttcaagca
ctcaatcagtttgcgattttaaatgaccatattgaaaatgagatgattgatggtggtgta
tttccagaattggttgctgagaaaaaaatccaaggcgtaccagcggtatttttaaacggt
aaaccttttgctaatggtaaggttgatactgccaaactgattgaaaaacttcaagagcag
tatccaaatttattagcatcagcaaatgaagtccagcttgaaacacaagatgttacagtc
atcggtggcggtccagcaggcacagcggcagcaatctatactgctcgtaaaggattgcgt
gttgcgatcgtggcagatcgtatcggtggtcaggttaaagatacgcaagatatcgaaaac
ttaatttctattcctttgaccaatggtaatacattggctgcgaatttggcaacacacata
aaagagtacaatattactgtcaaagagcatgtcagcgtaagcaagcttgaggaggttgat
ggtggctatcaggtgactttaagcacgggtgccagctggctttctcgtactgtgattttg
gcaactggtgccaaatggcgtaagcttggtgttaagggtgaggatgaaaatattggtaat
ggagtcgcctattgcccacactgcgatggcccattttttaaaggtaaagatgttgcggtg
attggcggtggtaactcaggtgttgaggcggcgttggatttggcggggattgtcaatcat
gtgactgtcttggagtttggtgactcattgcgcgccgatcaagtgttaattgacaaagct
gaagcacgagagaatatcacaattataaaatcagcagcaacgaccgaaatcactactgat
ggtagtaaagtgaatgcgttgatttatcaagatagagtgagtggcaatagccaaacattg
ccattatctgctgtttttgtccaaattggcttggtgccaaattcagagattgccaaaggc
ttggtaacaatgacgccgcaaggtgagattgaaattgacgccaaatgtcgcacaagtaag
gttggtatttttgcttgtggtgatgtgacaacagtgccatataagcagattaatattgcc
atgggtgagggttctaaagcaggattagcggcttttgagtatctgatgatgaatggctga

DBGET integrated database retrieval system