KEGG   Moraxella catarrhalis BBH18: MCR_1592Help
Entry
MCR_1592          CDS       T01224                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl(asn/Gln)-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00970  Aminoacyl-tRNA biosynthesis
mct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mct00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCR_1592 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mct03029]
    MCR_1592 (gatB)
Enzymes [BR:mct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MCR_1592 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MCR_1592 (gatB)
Mitochondrial biogenesis [BR:mct03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MCR_1592 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Rhomboid_SP
Motif
Other DBs
NCBI-ProteinID: ADG61849
UniProt: D5V8G0
LinkDB All DBs
Position
1566882..1568354
Genome map
AA seq 490 aa AA seqDB search
MTQQAPLIDGYEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGALPVLN
AGVIERALKFGMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAG
QKDEYTKRIGITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVA
YVKTIHELVTWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKS
EIERQIDVIEDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLA
KVRADMPELPSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWV
MGELSGSLNKNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEII
TEKGLKQETDTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQV
NALLKQMIGA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacaagcccccctaattgacggctatgaagttgtgattggtattgagattcat
tgccaattaaatactgacagcaaaatcttttcaaacgcccccaccgtctttggacaagaa
ccaaatacccaagccaccattgtagatttgggctttcctggggcgttgcctgtcttaaat
gcaggcgtgattgagcgtgccttaaaatttggcatgggtgtcaatgccaaacttggcact
tataacacttttgaccgcaaaaattacttttatcctgacctgcccaaaggctatcaaatc
acgcaaatggcaaatcctattgtgggcgagggttatattgacattttggtcaatgcaggg
caaaaggatgaatacaccaaacgcattggtatcacacgagctcacctagaagaagacgct
ggtaaatcggtgcatgatgctgtaccgcagatgacgggtgtggatttgaaccgtgcaggc
accccgctcattgagattgtctctgaacctgacatgcgttcggttgatgaggcggttgct
tatgtcaagaccattcacgaactggttacatggctgggtatcagtgatgccatcatggca
gagggttcatttcgggcggacattaatgtgtcggtacacaagccaaacacgccctttggt
actcgctgtgagcttaaaaacctaaactcatttcgctttattcaccgtgctatcaagtct
gagattgaacgccaaattgatgtcatcgaagacggtggcaaagtcgtgcaagccacacgc
ctatatgaccctgagcgtgatgaaactcgtgccatgcgtaccaaagaagaagccaacgat
taccgctactttccagaccctgacctgttgcctgtcatcatatcagatgagacacttgcc
aaggtgcgtgccgatatgccagagctgccaagcgtacgcaaagagcgatttgtgaatgaa
tttggcttgaccgcctatgatgccaatgtactaaatggcagtcgtgaactgtcggattat
ttcttgcaagtacttgatatcattggtaaaaataatgccaaaatcgcagccaactgggtc
atgggtgagctgtcaggctcactgaacaaaaatgagctgaccattgaccaatcacccatc
agtgccaagcgtttggcagggctgattgtgcgaattttggatgataccatcagcggtaaa
atcgccaaagaggtgtttggtcatctgtgggagtctgacaaaagtgctgatgaaattatc
accgaaaaaggactaaaacaagagaccgacacaggggcaattgaagccatcatcgtcgat
gtacttgccaataaccaagccatggtggatgaatacaaaggcggaaaagaaaaagccttt
aatggactggtcggacaagtgatgaaagcaagccgtggcaaggcaaaccccgctcaggtc
aatgcgttattaaaacagatgattggagcgtaa

DBGET integrated database retrieval system