KEGG   Mobiluncus curtisii: HMPREF0573_10268Help
Entry
HMPREF0573_10268  CDS       T01257                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00500  Starch and sucrose metabolism
mcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0573_10268
Enzymes [BR:mcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF0573_10268
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     HMPREF0573_10268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADI66587
UniProt: D6ZIN8
LinkDB All DBs
Position
319469..321256
Genome map
AA seq 595 aa AA seqDB search
MLAFSSLRLWGNLNIFLIFFPRHQVTNLQGVYIIFGAPDSPQPRERSVRYFEVFVTYLLP
HPKERIFVSTSYPRPKWLNNAVFYEIYPQSFQDSNGDGIGDVPGIISRLDYLQELGINAL
WLNPLFDSPFKDAGYDVRDYKLVAPRYGTNEDLVRLFEQAHARGIHVLLDLVPGHTSEEH
AWFQSSSRPEPNEFSNRYVWTDSWIAGGDGYPFIGGETERDGTYILNFFKCQPALNYGWA
HPKYPWQDEALGEAARKTCDAMVDVMRFWLSAGADGFRVDMANSLVKHDDEGKPYTIKTW
HYMFDQIRPEFPEAAFVAEWGVPHEAVQAGFDMDFYLDWRWDNHPNGYNILLRNTNTPYV
RENDLSYFNADAPTDICGFLEQYEPQLRDSEKAEAFFSLITCNHDTWRAAPRLSERELSL
SWATILTLPGVPFIYYGDEIGLRHQLLPTKEGGYVRTGARTPMQWDSTDNLGFSTAPATD
LYLPVDASADAPTVAAQRAQPDSLWHTVTRVLECKRELPALAADSGFSVLSAEPNQRLFV
FKRENAAQSLIVAVNPAHTDAEYDLSQERSVRFSIGSAQLTGTTLRMGPQSFAIL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgctagcattttcttccctgcggctttggggaaatctcaatatttttttaatatttttt
ccccgtcaccaggtcactaatttacagggtgtttacatcatctttggtgcgccagattca
ccccaaccacgagagcgttctgtaagatattttgaggtctttgtgacctatctattaccg
catcccaaggaaaggatttttgtgagcacctcatacccccgtcccaaatggctgaataac
gcggttttctatgagatttatccccagagttttcaggactctaacggagatggcatcggg
gatgttcccggcatcatctcccgcttggactacctccaagagctaggaattaacgcgctg
tggctcaatcccctgttcgattcacctttcaaggacgcgggatacgacgtgcgtgactac
aagctggtggctccccgctacggcactaacgaggatttggtacgtttgttcgagcaagcg
cacgccagggggattcacgtgttgctggatttggtaccggggcacacctccgaggaacac
gcctggttccaatccagctcccgtcccgagcccaacgagttctcgaatcgctacgtgtgg
accgactcctggattgccggaggcgacggctatccctttatcggtggagaaactgaacgc
gatgggacgtatatcctcaatttcttcaaatgccagcctgcgctgaactacggttgggcg
cacccgaagtatccctggcaagacgaggctttaggtgaagctgcccggaagacctgtgac
gcgatggtggacgtcatgcgcttctggctctctgccggcgccgacggattccgggtagac
atggcaaattccctggtgaaacatgatgacgaaggtaagccgtacactatcaagacctgg
cattacatgtttgaccagattcgccctgaattccccgaagccgcgtttgtcgccgagtgg
ggggtgccccacgaagcggtgcaagccgggtttgacatggacttttatctagattggcgg
tgggacaatcacccgaacggctacaacatcctgctacgcaacacgaacaccccgtatgtg
cgggaaaacgacctgagctacttcaacgcggacgcacccaccgacatctgtggtttcttg
gagcaatacgagccacaactgcgtgactctgagaaagccgaagcattctttagcctcatt
acctgcaatcacgacacctggcgggctgcgcctcgtctgagcgaacgcgaactcagtctg
tcgtgggcgacaatactgaccctgccgggagtgccatttatttattacggagacgaaatt
ggtttgcgtcaccagctgctccccaccaaagagggcggttacgtgcgtaccggagcccgc
accccgatgcagtgggatagtactgacaacctgggattttccactgctccagcaacggat
ctctatctgccggtcgatgctagcgcggatgctcccaccgtggcggcacagcgcgcccag
ccggattctttgtggcacacggtgacgcgcgtgttggaatgcaaacgagaactcccggct
ttggcagccgacagtggcttcagcgtcctctctgcggagccaaatcaacgtctgttcgtt
ttcaaacgggaaaatgccgcgcaaagcctgattgtggcggtcaatcccgcacacactgac
gcggaatacgatttgtcacaagagcgttcggtgcgtttcagtatcggctccgcccagttg
acggggaccacgctacggatgggaccccagagtttcgcgattttgtaa

DBGET integrated database retrieval system