KEGG   Mobiluncus curtisii: HMPREF0573_10271Help
Entry
HMPREF0573_10271  CDS       T01257                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00010  Glycolysis / Gluconeogenesis
mcu00030  Pentose phosphate pathway
mcu00051  Fructose and mannose metabolism
mcu00052  Galactose metabolism
mcu00680  Methane metabolism
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01120  Microbial metabolism in diverse environments
mcu01130  Biosynthesis of antibiotics
mcu01200  Carbon metabolism
mcu01230  Biosynthesis of amino acids
mcu03018  RNA degradation
Module
mcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10271
   00030 Pentose phosphate pathway
    HMPREF0573_10271
   00051 Fructose and mannose metabolism
    HMPREF0573_10271
   00052 Galactose metabolism
    HMPREF0573_10271
  09102 Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10271
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0573_10271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcu01009]
    HMPREF0573_10271
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcu03019]
    HMPREF0573_10271
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0573_10271
Protein phosphatases and associated proteins [BR:mcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0573_10271
Messenger RNA biogenesis [BR:mcu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF0573_10271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADI66590
UniProt: D6ZIP1
LinkDB All DBs
Position
complement(324246..326576)
Genome map
AA seq 776 aa AA seqDB search
MGGSAKTAKTGKSSAKPKSTQSGQEKRIGILTSGGDAQGMNAAVRSAVRSAIVLGAKPFA
IREGWMGAVQGGSCIHELSWGDVSNTISKGGTIIGTARCPEFRDWEGRLKACENLVKNGI
DRLVSIGGDGSLRGTEELRQDWPKLLAQLVEEKRLSPEEAKAHSSLRIVGLVGSIDNDMA
GTDMTIGTDSALNRILAALDQLSSTAASHQRTFVVEVMGRNCGYLALMSAVAGGSDYVLF
PENPPAPGWEEDMCTVLSEGRKHGRRDSIVVVAEGAKDRDGQPITAHYVAEAIEQRTGES
ARVTILGHIQRGGTPSVYDRWMPTLLGYAAVQDVIEAQPGDPAKVMGVRYNRIARLDLTQ
TVAATSNVHELIKSGEYDQAIASRGTSFTDMVEIFRVLSTPPSLLKPLLRKAKKVAVMHV
GGLAPGMNMAARAAVRFGLQRGLEVLGIEGSWQGLIDGKVHKLRWKDVEGWDFRGGAELG
TKREVPTVEQFYAIGRSIENHHIDALVLIGGYNAYLSAQAISEELKHYPALQIPMVIVPA
SIDNNLPGAEISIGTDTALNNAVWSMDLMKESAAASKRCFITETMGRHCGYLALMSGIAA
GAERVYLEEENISLETLGKHATEMREAFAKGRRLALVVRNELAGGHYDLKFMANVFKQES
LGHFDVRIDSVGYLQQGGAPSPFDRLLAVRLMWETMRHIDVALDSGQCAIEYIGEENGQM
SYHDISQMEKQVNPEKRRPINQWWMGLRPLIEVMASSNPPIKDFPLPVIDMSGPRS
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggtccgcaaagacggcaaaaactggaaaatctagcgcgaaaccgaaatcgacg
cagtcgggtcaggaaaaacgcatcggcattctcacttcgggaggggacgcacagggcatg
aacgcagcggtacgttccgcggtgcgttccgccatagttttgggagccaagccgttcgcg
atacgcgaaggctggatgggtgcagtccagggtggctcctgcattcacgaactgagttgg
ggggatgtctccaatacgatttccaagggcggtaccatcatcggtacagctcgttgcccg
gagttccgggactgggaagggcggctgaaagcctgcgaaaacctggttaaaaacggcatt
gaccggctcgtttctatcggcggtgacgggtcgttgcgggggacggaggaactgcgccaa
gactggcccaagctcttggcacagctggtagaggaaaaacgtctcagccctgaggaagcc
aaagctcactcgtccttgcgaattgtcggcttagtcgggtctattgacaatgacatggcg
ggcacagatatgactatcggcactgattctgccttgaaccgaatcttggcagcgctggat
caactctcgtccactgccgcttcgcatcaacgcaccttcgtggtggaagtcatgggacga
aactgcggttatttagctttgatgagcgctgtagcgggtggttctgactatgtcttgttt
cccgaaaatcctccggctcccggctgggaggaagacatgtgtacggtactcagcgaaggt
cgcaagcacgggcggcgcgactccatcgtggtcgtggcggaaggggcaaaagaccgggat
ggtcagcccatcactgcgcactatgttgctgaggccatagagcagcgcactggagagtcc
gcgcgagttaccattttgggacacattcagcggggcgggacgccctcggtttacgaccgg
tggatgcccaccctgctggggtacgctgcggtacaggacgtcatcgaggcacaaccggga
gatcctgccaaagtcatgggggtgcgttacaaccgaattgcccgactcgacctgactcag
accgtggcggcgacctcaaatgttcacgaactgattaagtccggagaatacgaccaagct
atcgcctcacgggggacttcctttaccgatatggtagagattttccgggttctgtccacc
ccgccctcactgctgaaacctctgcttcgcaaggcgaaaaaagttgcggtgatgcacgtt
ggtggcttggctccggggatgaacatggcggctcgagccgcagttcgattcggactgcag
cgcggcttggaagtcttagggatagagggttcctggcagggactcatcgacggcaaagtc
cacaaactgcggtggaaagatgtagagggctgggacttccgaggcggagccgagctggga
accaaacgggaagtgcccacggtagaacagttctatgctatcggtcgctcgattgaaaac
caccatattgatgcgctggtgctgatcgggggatataacgcgtacctgtctgcccaagcc
atcagcgaggaactgaaacattatccagctctacaaatacctatggtcatcgtcccggcc
tccattgataacaaccttccgggagccgaaatttctatcgggactgacaccgcgctaaac
aacgcagtatggtccatggatttgatgaaagaatcagcagccgcttcaaagcgttgtttc
atcactgaaactatgggtcgccactgtggctatctggccctgatgagtggcattgctgcc
ggggcagagcgggtttacctggaagaagaaaacatcagcctagagacgctgggcaaacac
gccactgaaatgcgtgaagcttttgcaaaaggtcgtcgcctcgccctggtggttcgcaac
gaactggctgggggacattatgacctgaagtttatggccaacgtgttcaagcaggaatcc
ctgggacacttcgacgttcgtatagattcggtggggtatctgcagcaaggcggggcgccc
tcgccttttgaccggcttctcgcggtacgtctgatgtgggagactatgcgtcacattgat
gttgccctagattctggacagtgcgccattgaatatatcggcgaagaaaatggtcagatg
tcataccacgacatttctcaaatggagaaacaagtcaatccagagaaacgtcgccctatc
aatcaatggtggatggggttgcgaccgctgattgaagtgatggccagttcgaatccgcca
atcaaagacttccccctgccggtcatcgacatgagcggaccgaggtcgtaa

DBGET integrated database retrieval system