KEGG   Methanobacterium congolense: MCBB_0167Help
Entry
MCBB_0167         CDS       T04503                                 

Gene name
GAD
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mcub  Methanobacterium congolense
Pathway
mcub00250  Alanine, aspartate and glutamate metabolism
mcub00410  beta-Alanine metabolism
mcub00430  Taurine and hypotaurine metabolism
mcub00650  Butanoate metabolism
mcub01100  Metabolic pathways
mcub01110  Biosynthesis of secondary metabolites
mcub01120  Microbial metabolism in diverse environments
mcub02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mcub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MCBB_0167 (GAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MCBB_0167 (GAD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCBB_0167 (GAD)
   00430 Taurine and hypotaurine metabolism
    MCBB_0167 (GAD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MCBB_0167 (GAD)
Enzymes [BR:mcub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MCBB_0167 (GAD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: SCG84755
UniProt: A0A1D3KZK6
LinkDB All DBs
Position
I:complement(184096..185502)
Genome map
AA seq 468 aa AA seqDB search
MEGLNTLSGKKNLEKMKVSEKEVTSTYGSRYFTESIPKYVMPEDEMPARAAYQLIHDELN
LDGNPALNLASFVTTWMEPEADKLIMESMDKNFVDNDEYPQTEKIQERVINMLARLFNAP
KECHSVGTGTIGSSEAIMLGLLAHKWTWKKRRQEEGKPFNKPNIVMGADVHTVWEKFALY
FDVELKLIPLERDTYTVTVDKVAEEIDENTICVGAVLGTTFTGQMDPIKEINDLLMDIKK
ENGWDIPIHVDGASGGFVAPFLYPELEWDFRLEQVRSINVSGHKYGLVYPGVGWLIFKDK
TDLPEELIFKVNYLGGLMPNYSLNFSKGSSTIIAQYYNLIRLGKSGYTDIMENMMSNSQY
LARKLEDSGKFEIINKEGMFPLVTVSLKDEEFTVFQLSEKLRQKGWIVPAYTLPENAEDV
AVMRMVVKENFGREMIDLLVDDVMEACESFEGEETVEKVEDQNPSLLY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaggggttaaatacgttatctggaaagaaaaatttggagaaaatgaaggtatctgag
aaggaggtgaccagcacctatggaagtaggtacttcactgaaagcattccaaagtacgtt
atgcccgaggatgaaatgcccgcaagggcggcgtatcaactgatacacgatgaactgaac
ctggatgggaatcctgccctgaacctggcgagttttgtgacaacctggatggagcctgag
gctgacaagctcataatggagagcatggataaaaacttcgttgacaacgacgagtatcct
cagactgagaaaatacaggagagggttattaacatgctggccaggcttttcaacgcccca
aaggagtgtcattccgtgggaacagggaccataggctcgtctgaggccataatgctcgga
cttctggcccataaatggacctggaagaaaaggagacaggaagaggggaaacccttcaac
aaacccaacatagttatgggtgcagatgttcacacggtctgggagaagtttgcactttac
ttcgatgttgagctgaagctcataccccttgaaagagacacttacacagtcacagtggat
aaggtggcagaggaaatagatgaaaataccatatgcgttggtgctgttcttggaacaacc
ttcacaggccagatggaccctataaaagagataaacgatcttttgatggatattaaaaag
gaaaatggttgggacataccaatacatgttgacggtgccagtggaggttttgtggcaccg
ttcctctatcctgaactggaatgggatttcagactcgaacaggttcgatccatcaacgtt
tccgggcacaagtacggtctcgtgtatcctggagtgggctggctcatattcaaggataaa
acagacctccctgaggaactcatattcaaggtgaattacctgggaggtttgatgcccaat
tactccctgaacttctccaagggaagcagcacaataatagcccagtactacaacttaata
agacttggaaaaagtggttacaccgacataatggagaacatgatgagtaacagccagtac
ctcgccagaaaacttgaggattcaggtaaatttgagatcatcaacaaggaggggatgttc
ccacttgtaacagtgagtttgaaggatgaagaattcacggttttccagctttcagagaaa
ctgagacagaaaggctggatcgttcctgcatacacactccctgagaatgctgaggatgtt
gcagtcatgaggatggttgtgaaggaaaacttcggcagggaaatgatcgacctgcttgtt
gatgatgtgatggaagcctgtgaatcctttgaaggtgaagaaacagtagaaaaagtggaa
gatcagaatccttccctcctatattaa

DBGET integrated database retrieval system