KEGG   Methanobacterium curvum: MCBB_0172Help
Entry
MCBB_0172         CDS       T04503                                 

Gene name
lig
Definition
(GenBank) DNA ligase {ECO:0000255|HAMAP-Rule:MF_00407}
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mcub  Methanobacterium curvum
Pathway
mcub03030  DNA replication
mcub03410  Base excision repair
mcub03420  Nucleotide excision repair
mcub03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcub00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MCBB_0172 (lig)
   03410 Base excision repair
    MCBB_0172 (lig)
   03420 Nucleotide excision repair
    MCBB_0172 (lig)
   03430 Mismatch repair
    MCBB_0172 (lig)
Enzymes [BR:mcub01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MCBB_0172 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     MCBB_0172 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MCBB_0172 (lig)
DNA replication proteins [BR:mcub03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MCBB_0172 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MCBB_0172 (lig)
DNA repair and recombination proteins [BR:mcub03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MCBB_0172 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     MCBB_0172 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     MCBB_0172 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: SCG84760
UniProt: A0A1D3KZR8
LinkDB All DBs
Position
I:189763..191454
Genome map
AA seq 563 aa AA seqDB search
MNSKDGMRYMELVDVYEKLDSTTKRLEKTTILADFFRKIGGEDPELLPVVTLLSLGRVFP
TWSEEELGIASKLLMNAMALVAGVRPEDVEDMMRDAGDIGTAAELLLGKKKQATFFTVPL
TIQKVHSNLMKIADISGNRSQYKKMEILRELFSSASPEEAKYITRTVLEELRVGVGEGTI
KDAIAEAFSVEKGVVERAHMLTNDLGLVSEVAKEEGVEGLKKLSLKPGKPVKPMLAQLSP
GIRESVEEMGWALCETKYDGIRVQIHRSGDEVNIFTRRLENISNAVPEIIEYIEEALPHE
DFIVEGEIIVTKDGKPISFQYILQRVRRKYEIEKMREQVPLKLYLFDVLYYHGPQIDTPF
EDRRKILESMVDVMEDKLQLSNQVKATPEDIWRAEDLFTESLKGGHEGIMIKDPHAPYMP
GIRGKKMLKRKAEPETLDLVVVGGTYGKGKRAHFIGSYLLAVQDENNELKTIAHAATGLD
DQMLLELSEMVEPLITKKTGRRVEIVPSIILEIAYSEIVKSPEYESGYSLRFPVVKRVRE
DISIEDIDTVERVESMFKDVQTL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaggatggaatgaggtacatggaacttgtggatgtatacgagaagttggac
tccacaaccaagaggcttgaaaaaaccaccatactcgcggattttttcaggaaaataggg
ggagaagatccggagcttcttccagttgttacactgctctcccttggaagggttttccca
acatggagtgaggaggaacttggaatagcatcaaaactccttatgaatgcaatggcactg
gttgcaggagttaggcctgaggacgttgaggacatgatgcgggatgcaggggatattgga
accgctgcagaactacttcttggtaaaaaaaagcaggcaacatttttcacagtccccctg
accatccagaaggttcacagcaacctcatgaagatagcagatatttcaggaaacaggtcc
cagtacaagaagatggagatattacgggaactcttctcatctgcatccccggaggaggcc
aagtacatcacaagaacagtgcttgaagagctcagggttggagtgggtgagggaaccata
aaggatgccattgcagaagctttctcagttgagaaaggggtagttgaaagggcgcacatg
ctcacaaatgatcttggtcttgtttcagaggttgcaaaggaagaaggtgttgaaggactt
aaaaaactcagcctcaaaccaggaaaacctgtcaagccaatgctagcacagctctctcct
gggatcagggagagtgttgaggagatgggttgggctctctgtgaaaccaagtacgacggt
ataagggttcagatacacagatcaggggatgaagttaacatattcaccagaagacttgag
aacatctccaatgcagttcctgaaatcattgagtacatagaagaagcattgccccatgag
gatttcatcgttgaaggtgaaataatcgttacaaaggatggtaaacctatatctttccag
tacatactccagagggtcaggaggaagtacgaaatcgagaagatgcgcgaacaggtgcca
ctgaagctctacctttttgacgtgctgtactaccatggtcctcagatagatacgcccttc
gaggacaggcgtaagatacttgaatccatggttgatgtaatggaagataagctccagctt
tccaatcaggtgaaggccacacctgaggatatctggagggctgaagatctcttcacagaa
tcactgaaggggggacatgagggtataatgatcaaggatccccatgcaccttacatgccg
ggcatccgaggcaagaaaatgctcaaaagaaaggcagaacctgaaaccctggatctggtg
gttgttggtggaacctacggtaaaggtaagagagctcacttcataggttcatatctgctg
gcagttcaggatgaaaacaacgaactgaagaccattgcacatgcagcaaccggtctggac
gatcagatgcttctggaactatctgagatggttgaaccccttataaccaagaaaacaggc
agaagggtggagatagttccatccatcatccttgagattgcctacagtgagatcgttaag
agcccggagtacgagagtggatactccttgaggttccctgttgttaagagggtaagggaa
gatataagtattgaggatattgacacggttgaacgtgttgaatcgatgtttaaagatgtt
caaacgctttaa

DBGET integrated database retrieval system