KEGG   Mycobacterium canettii CIPT 140070008: BN43_10279Help
Entry
BN43_10279        CDS       T02420                                 

Definition
(GenBank) Putative succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00020  Citrate cycle (TCA cycle)
mcv00190  Oxidative phosphorylation
mcv00650  Butanoate metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
Module
mcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_10279
   00650 Butanoate metabolism
    BN43_10279
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN43_10279
Enzymes [BR:mcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN43_10279
    1.3.5.4  fumarate reductase (quinol)
     BN43_10279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 Fer4_16 Thioredoxin_7 Fer2_4 Fer4_10
Motif
Other DBs
NCBI-ProteinID: CCK54198
LinkDB All DBs
Position
complement(299431..300177)
Genome map
AA seq 248 aa AA seqDB search
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacagcgcgagtatgcgggtgtggcgaggagacgaaagctgtggcgaactccgc
gaattcaccgtggaggtcaacgagggcgaggtcgtgctggacgtcatcctccgtctacaa
cagacgcagacaccggatctcgcagtgcgctggaattgcaaagctggcaagtgcggatcc
tgctcggccgagatcaacggcaaaccgcgactgatgtgcatgacgcggatgtcgacattc
gacgaggacgagatcgtcacggtcaccccaatgcggacgttcccggtgattcgcgatctt
gttaccgacgtctcgttcaactaccaaaaagcgcgcgagatcccgtctttcgcgccaccc
aaggagctacagcccagcgagtaccgaatggcgcaagtcgacgttgcacgctcgcaggag
ttccgcaagtgcattgaatgcttcctgtgccaaaacgtctgccacgtagttcgcgatcac
gaggaaaacaaggatgcgttcgccggcccccgcttcctgatgcgaatcgccgaactcgaa
atgcatccgctggacacccgggaccgacgcagccaagcacaggaagagcacggcctgggc
tactgcaatatcaccaagtgctgcaccgaagtgtgcccagaaaacatcaagatcaccgac
aatgccctgatcccgatgaaagaacgggtcgccgaccgcaagtatgatccggtggtatgg
ctgggcagcaagctgtttcgccgctaa

DBGET integrated database retrieval system