KEGG   Mycobacterium canettii CIPT 140070008: BN43_10280Help
Entry
BN43_10280        CDS       T02420                                 

Definition
(GenBank) Putative succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00020  Citrate cycle (TCA cycle)
mcv00190  Oxidative phosphorylation
mcv00650  Butanoate metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
Module
mcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_10280
   00650 Butanoate metabolism
    BN43_10280
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN43_10280
Enzymes [BR:mcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN43_10280
    1.3.5.4  fumarate reductase (quinol)
     BN43_10280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CCK54199
LinkDB All DBs
Position
complement(300178..302118)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAGAIDAAAQQALSPFEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagactcacttcggcgacacgatgcgcggtggaaagttc
ctcaacaactggcgtatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctggagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaggaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggcgcgatcgccggagccttcggctactggcgggaaagcggccggttcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggatcggcaagtcgttcaaggtgacatcc
aactcctgggagtacaccggagacgggcacgcgttggcactgcgggccggggcgacgctg
atcaacatggagttcgtccaattccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgagggtgttcgcggcgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtacgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacccgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccagggctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcgctgagcagccggccagcggtttcagcgggggct
atcgatgcggcagcccagcaggcgctgagccccttcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgctgcatatggacttgcagtacgtgatgaacgatctggtcggt
atcatccgcaacgccgacgaaatatccagggcgctgactcttttggccgagctgtggtcg
cgctaccacaacgtactcgtcgaaggtcaccgtcaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctacagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aggatcttgctggtatgccgggccaccgaaaccatgggcaccggtggcagcgggtccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaaatactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system