KEGG   Mycobacterium canettii CIPT 140070008: BN43_40209Help
Entry
BN43_40209        CDS       T02420                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase AroK (SK)
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01130  Biosynthesis of antibiotics
mcv01230  Biosynthesis of amino acids
Module
mcv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN43_40209 (aroK)
Enzymes [BR:mcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BN43_40209 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_17 AAA_5 Mg_chelatase KTI12 Cytidylate_kin AAA AAA_22 ParA 6PF2K MMR_HSR1 CoaE Gly_kinase AAA_28 AAA_16 AAA_24
Motif
Other DBs
NCBI-ProteinID: CCK56590
LinkDB All DBs
Position
complement(2915022..2915552)
Genome map
AA seq 176 aa AA seqDB search
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRI
EEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLL
AGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaagcggttctcgtcggcctgccgggctccggcaagtccaccatcgggcgc
cggctggccaaggcgctcggggtcggcctgctcgacaccgacgtcgcgatcgagcagcgg
accggacgcagcatcgccgacatcttcgccaccgacggggagcaggagttccgacgtatc
gaggaggacgtggtgcgcgcggcactggccgaccacgacggtgtgctgtcgctcggcggc
ggcgcggtgaccagccccggtgtgcgcgcggcgctggccggccacaccgtcgtctacctg
gagatcagcgccgccgagggcgtgcgccgcaccggcggcaacaccgtgcgcccactgctg
gccggccccgaccgtgccgaaaaataccgcgcgctgatggccaagcgggcaccgctgtac
cggcgcgtcgcgaccatgcgagtggacaccaatcgccgcaaccccggggcggtggtccgc
catatcctgtcgcggctgcaggttcccagccccagcgaggcggccacatga

DBGET integrated database retrieval system