KEGG   Microbacterium chocolatum: A8L33_00215Help
Entry
A8L33_00215       CDS       T04340                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw00250  Alanine, aspartate and glutamate metabolism
mcw00280  Valine, leucine and isoleucine degradation
mcw00310  Lysine degradation
mcw00410  beta-Alanine metabolism
mcw00640  Propanoate metabolism
mcw00650  Butanoate metabolism
mcw01100  Metabolic pathways
mcw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A8L33_00215
   00650 Butanoate metabolism
    A8L33_00215
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A8L33_00215
   00280 Valine, leucine and isoleucine degradation
    A8L33_00215
   00310 Lysine degradation
    A8L33_00215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8L33_00215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcw01007]
    A8L33_00215
Enzymes [BR:mcw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A8L33_00215
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A8L33_00215
    2.6.1.48  5-aminovalerate transaminase
     A8L33_00215
Amino acid related enzymes [BR:mcw01007]
 Aminotransferase (transaminase)
  Class III
   A8L33_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANG84047
UniProt: A0A0M8MMI7
LinkDB All DBs
Position
complement(44785..46143)
Genome map
AA seq 452 aa AA seqDB search
MTAIDTVAAPVGGPTLPQERRLVTEIPGPRSQELLARKAAAVAAGVGHTAPIEAVAAGGG
VVVDADGNSLIDLGSGIAVTTVGNAHPRVVEAVTAQVAQFTHTCFMVSPYESYVAVAEAL
NRVTPGDHEKKSALFNSGAEAVENAIKIARKFTKKQAVVAFDHGYHGRTNLTMALTAKSM
PYKSGFGPFASEVYRAPMSYPFRDGGLSGADAARKAISVIEKQVGAENLAAVIIEPIQGE
GGFIVPADGFLEHLLRWCRSNDVVFIADEIQTGFGRTGAMFASELFGIVPDLITTAKGIA
AGLPLAAVTGRADIMDAAHAGGLGGTYGGNPIACAAALAAIEVFESEDLPSRAREIETLL
TGRLRDLQASDPRIGDIRGRGAMIAVEFVVPSTGDPDGTLTSAIAKACIAQGVIVLTCGT
YGNVIRFLPPLSISDDLLHEGLDVIAAALAAH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatcgacaccgttgccgccccggtgggcgggcccactctgcctcaggaacgc
cgcctcgtcaccgagatccccggcccccgctcgcaggagctcctcgcgcgaaaggcggcc
gccgtcgcggccggtgtcggccacactgcgccgatcgaggccgtcgccgccggcggcgga
gtcgtcgtcgatgccgacggcaactccctcatcgacctcggctcgggcatcgccgtgacc
acggtcggcaacgcgcacccccgcgtcgtcgaggccgtcaccgcgcaggtggcgcagttc
acgcacacgtgcttcatggtctcgccgtacgagtcctacgtcgcggtcgcggaagcgctg
aaccgggtgaccccgggcgaccacgagaagaagtcggcgctgttcaactccggcgccgaa
gcggtcgagaacgcgatcaaaatcgcgcgcaaattcaccaagaagcaggccgtcgtcgcg
ttcgaccacggctaccacgggcgcacgaacctcacgatggccctgacggcgaagtcgatg
ccctacaagagcggcttcggcccgttcgcctccgaggtctaccgcgcgccgatgtcgtac
ccgttccgcgacggcggactcagcggcgcggatgccgcgcgcaaggccatctcggtcatc
gagaagcaggtcggcgccgagaacctcgccgccgtcatcatcgagcccatccagggcgag
ggcgggttcatcgtccccgccgacggattcctggagcacctcctgcgctggtgccgcagc
aacgacgtcgtcttcatcgccgacgagatccagaccggcttcggtcgcaccggcgcgatg
ttcgcctccgagctgttcggcatcgtccccgacctgatcacgaccgcgaagggcatcgcc
gcgggcctcccgctcgcggccgtcaccggtcgcgcggacatcatggatgccgcgcacgcc
ggcggcctcggcggcacctacggcgggaaccccatcgcctgcgccgcggcgctcgccgcc
atcgaggtgttcgagagcgaggacctgccctcccgcgcgcgggagatcgagaccctcctg
accggacgcctgcgcgacctgcaggcctcggacccgcgcatcggcgacatccgcggacgc
ggtgccatgatcgcggtcgagttcgtcgtgccctcgactggagaccccgacggcaccctc
acctccgcgatcgcgaaggcctgcatcgcgcagggcgtgatcgtgctcacctgcggcacc
tacggcaacgtgatccgtttcctcccgccgctgagcatctccgacgacctgctccacgag
ggcctggacgtcatcgccgccgccctcgccgcccactga

DBGET integrated database retrieval system