KEGG   Microbacterium chocolatum: A8L33_02780Help
Entry
A8L33_02780       CDS       T04340                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
mcw  Microbacterium chocolatum
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcw02000]
    A8L33_02780
Transporters [BR:mcw02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    A8L33_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_30 AAA_23 YCII MukB AAA_19 Zeta_toxin IglC SbcCD_C SRP54
Motif
Other DBs
NCBI-ProteinID: ANG84449
UniProt: A0A0M8MQ77
LinkDB All DBs
Position
573531..574415
Genome map
AA seq 294 aa AA seqDB search
MLQLSGVTKNYGSRRVLDDVSFTVKPGRLTGFVGGNGAGKTTTMRIVLGVLGKDGGSVTL
EGTDVTAADRRRFGYMPEERGLYPKMKVLEHIVYLARLHGFTKTDAEARGRALLEQLGLG
ERLGDNVETLSLGNQQRAQIAAALVHDPEVLILDEPFSGLDPLAVDVVAGVLQDRAAQGT
AVLFSSHQLDVVERLCDELVIIAGGTIRAAGEREALRAQHANRRFELVSAGDAGWLRDQP
GIEVLDFDGGYAVFDADSDDAAQRVLREALSRGDVASFAPQHPSLAQIFKEVIR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctatcgggcgtcaccaagaactacggcagtcgccgggtgctggacgacgtg
tccttcactgtcaagcccggtcgactcaccggcttcgtcggcggcaacggcgcggggaag
accacgacgatgcgcatcgtgctcggcgtcctcggcaaggacggcgggtccgtcaccctc
gaggggaccgacgtcaccgccgccgaccgccgccgcttcggctacatgcccgaagagcgc
gggctctacccgaagatgaaggtgctcgagcacatcgtctatctcgcgcggctgcacggc
ttcacgaagacggatgccgaggcacgcggccgcgccctgctcgagcagctcggactcggc
gagcgcctcggcgacaacgtcgagaccctgtcgctcggaaatcagcagcgtgcgcagatc
gccgcggctctcgtccacgaccccgaggtgctgatcctggacgagccgttctcgggcctc
gacccgctcgcggtcgacgtcgtcgccggggtcctgcaggaccgcgcggcgcaggggacc
gccgtgctcttctcgtcccaccagctcgacgtggtcgagcgcctgtgcgacgagctcgtc
atcatcgccggcgggacgatccgcgcggccggcgagcgcgaggcgctgcgcgcccagcac
gcgaaccgccgcttcgagctcgtctccgcgggcgacgcggggtggctccgcgaccagccc
ggcatcgaggtcctcgacttcgacggcggctacgccgtcttcgacgccgacagcgacgac
gccgcgcagcgggtgctgcgcgaagccctctcccgcggcgatgtcgcgagcttcgcgccg
cagcatccgtccctcgcccagatcttcaaggaggtcatccgatga

DBGET integrated database retrieval system