KEGG   Microbacterium chocolatum: A8L33_11835Help
Entry
A8L33_11835       CDS       T04340                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A8L33_11835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcw03400]
    A8L33_11835
Enzymes [BR:mcw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A8L33_11835
DNA repair and recombination proteins [BR:mcw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A8L33_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANG85981
UniProt: A0A0M8MMD8
LinkDB All DBs
Position
2481551..2483980
Genome map
AA seq 809 aa AA seqDB search
MSGKAQTVRVGTRTIRLTNLDKVLYPATGTTKGEVIEYYTRVAPVMLPHLRDRPVTRIRW
PEGVAEPAFFAKELEAGAPSWLRRRGIAHSRGPKMYPLVDDLAGLVYLAQVASLELHTPQ
WRFLHEDADGDERPRQADRLVLDLDPGPGVGLAECAEVARWARAVLDDMGMPPLPVTSGS
KGIHLYAPLPDGVTTDDAGALAHELARALEADHPDLVVSDMAKSRREGRVLLDWSQNNGA
KTTIAPYSLRGRERPTVAAPRTWQELEAPELAHLDFSEVMRRVDAEGDLLLTLLPSRPAH
VGGDLTTYIAKRNPGRTPEPLPSATPVIPSPELDRFVIQEHHASRLHWDLRLEHGGVLVS
WAVPRGIPATSTKNALAVMTEDHPIDYLDFAGEIPRGEYGAGSMTIWDTGRYELEKWRDD
EVIFTAEGRPGGPLGRVRFALIRTAGVGEKSTWLLHRMKTDAAGRTQPAARVEARTDAGP
PDPLPAWGALRPMLAVAASAAQARARASRRGSWAEAKWDGIRALVRWDGQDVTIRGRSGR
DMTAIYPELRAGPGGAPVILDGEIVALDNRHRPSFSRLQQRMNLTSAAEIAAARARIGVH
FFAFDVLAADGLDLTAMPLRERRGILERVLADAGPTYVLTPVFDDVEAALAASRATDLEG
IVAKDPASPYRSGARDEAWLKVVFTRRQDVVIGGIRPGRASRPGGIGSLLVGIPDQHGLR
YVGRVGSGFDDAALRELDRLLTPLRTSAVPFHHVPAADAADALWVRPVVVGEVEFARFTP
DGVLRHARWRGMRPDRDPLDVQVQGDQSG
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaaggcgcagacggtacgggtgggcacccgcacgatccgtctgaccaatctc
gacaaggtcctctatcctgcgaccgggacgaccaagggcgaggtcatcgagtactacacc
cgtgtggctccggtgatgctcccccacctccgggatcgccccgtcacccgcatccgctgg
ccggagggcgtggcggagccggcgttcttcgcgaaggagctcgaggccggcgcgccgagc
tggctgcgacgccgcggcatcgcccactcgcgcggacccaagatgtacccgctggtggac
gacctcgccgggctcgtctacctcgcccaggtcgccagtctcgagctgcacaccccgcag
tggcggttcctgcacgaggacgcagacggggatgagcgcccacggcaggcggacagactc
gtgttggacctcgatcccggcccgggagtgggactggcggagtgcgcggaggtcgcacgc
tgggccagagcggtcctggacgacatggggatgccaccgcttcccgtcacgagcggaagc
aagggcatccatctctacgccccccttccggacggggtcacgaccgatgatgccggcgcg
ctcgcccatgagctcgcgcgcgcgctcgaggcggaccatcccgatctcgtcgtgagcgac
atggcgaagtcgcggcgcgaggggcgcgtcctgctcgactggtcgcagaacaacggcgcc
aagacgacgatcgcgccctactcgctgcgtggacgggaacgtccgaccgtcgccgccccg
cgcacctggcaggagctcgaggcaccggagctcgcgcacctggatttctccgaggtcatg
cgccgcgtcgacgcggagggcgacctcctcctgaccctcctcccctcccgaccggcgcac
gtcggcggcgatctcaccacatacatcgcgaaacgcaaccccgggcgcacgcccgagccg
ctcccttccgcgacacccgtgatcccgtcgccggagctcgaccgtttcgtgatccaggag
caccacgcctcccggcttcactgggatctccgactcgagcacggcggcgtcctggtcagc
tgggcggtgccgcgcgggatccccgcgacgtcgacgaagaacgccctcgcggtgatgacc
gaggaccaccccatcgactacctcgacttcgcgggcgagatcccgcgcggcgagtacggc
gcaggatccatgacgatctgggacaccggtcgttacgagctcgagaagtggcgggacgac
gaagtcatcttcaccgcggaggggcgccccggcggtcctctcgggcgggtgcggttcgct
ctcatccggacggccggggtcggcgagaagtccacctggctcctgcaccgcatgaagacg
gatgccgccggtcggacccaacctgccgcgcgcgtcgaggctcggaccgacgccggaccg
cccgatcctcttccggcgtggggggcgctgcggcccatgctggcggtggcggcgtcagcg
gctcaggcacgtgcgcgggcgagccgacgcggctcgtgggcggaggccaagtgggacggc
atccgggcgctcgtccggtgggacggccaggacgtgaccatccgcgggcgcagcggacgc
gacatgaccgcgatctatccggagctgagggcgggacccggcggcgctcccgtcatcctg
gacggtgagatcgtcgcactggacaatcggcaccgcccgagcttctcccgcctccagcag
cggatgaacctcacctccgccgccgagatcgcggcggcgagggcacgcatcggcgtgcac
ttcttcgccttcgacgtcctcgccgcggacggcctcgacctcaccgccatgccgttgcgg
gaacgccgtggcatcctcgaacgcgtcctggccgacgcgggtccgacgtacgtcctcacg
cctgtgttcgacgacgtcgaggcggccctcgcggcgtcgcgcgcgacggacctcgagggg
atcgtggccaaggaccccgcctccccctaccgctccggtgcgcgggacgaggcgtggctg
aaggtggtgttcacccgccggcaggacgtcgtcataggcggcatccgtcccgggcgcgcc
tcccggccgggaggcatcgggtcgctcctggtcggcattcccgaccagcacggcctccgc
tacgtggggcgcgtggggagcggcttcgacgatgcggcattgcgcgagctcgatcgccta
ctgaccccgctgcgcacatcggcggtacccttccaccacgtcccggccgccgacgcggcg
gacgccctctgggtgcgccccgtcgtcgtcggtgaagtggagttcgcccggttcacgcct
gacggcgttctccgccacgcccgatggcgcgggatgcggccggacagagatccgctcgac
gtccaggtgcagggcgatcagtcagggtga

DBGET integrated database retrieval system