KEGG   Mycobacterium canettii CIPT 140070010: BN42_41385Help
Entry
BN42_41385        CDS       T02421                                 

Gene name
moaC
Definition
(GenBank) Molybdenum cofactor biosynthesis protein C3 MoaC3
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00790  Folate biosynthesis
mcx01100  Metabolic pathways
mcx04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN42_41385 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BN42_41385 (moaC)
Enzymes [BR:mcx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     BN42_41385 (moaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaC DUF4402
Motif
Other DBs
NCBI-ProteinID: CCK61453
LinkDB All DBs
Position
complement(3851467..3852021)
Genome map
AA seq 184 aa AA seqDB search
MQPAGGTVNDHDGVLTHLDEQGAARMVDVSAKSVTLRRARASGAVLMKPSTLDMICQGTA
AKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLEPQGADRLSIAATVTTVARTG
VEMEALTAVTVTALTVYDMCKAVDRAMTITDIRLDEKSGGRSGHYRRHDADVKPSDGGST
EDGC
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagcaggtggcacggtgaacgatcacgatggggtgcttacccaccttgatgaa
caaggtgccgcccgaatggtcgatgtgtcggcgaagtcggtgaccttgcggcgagcgcgg
gcatccggggccgtcctgatgaaaccgtcgaccctggacatgatctgccagggcaccgcg
gcaaagggcgatgtcatagcgaccgcacggatagccggcattatggcggccaaacggacc
ggtgagcttatcccgctgtgtcacccgctggggatcgaggcggtcaccgtcacgctcgag
ccgcagggtgcggaccggctctcgattgcggcgacggtgaccacggtggcacgtacgggt
gtggagatggaggcgttgaccgccgttacggtgacagcgctcacggtttacgacatgtgc
aaagcagtcgaccgtgccatgacgatcacggatatcagattggacgaaaaaagcggtggc
cgatcgggtcattaccggcggcacgacgcggacgtcaaacccagcgatggtggctccacc
gaggatggatgttga

DBGET integrated database retrieval system