KEGG   Mycobacterium canettii CIPT 140070010: BN42_50082Help
Entry
BN42_50082        CDS       T02421                                 

Gene name
alr
Definition
(GenBank) Alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00473  D-Alanine metabolism
mcx01100  Metabolic pathways
mcx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN42_50082 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN42_50082 (alr)
Enzymes [BR:mcx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BN42_50082 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mcx01011]
 Precursor biosynthesis
  Racemase
   BN42_50082 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCK61546
LinkDB All DBs
Position
complement(3954966..3956126)
Genome map
AA seq 386 aa AA seqDB search
MAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQLMAVVKADGYGHGATRVAQTAL
GAGAAELGVATVDEALALRGDGITAPVLAWLHPPGIDFGPALLADVQVAVSSLRQLDELL
DAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALRQAMAEDAVRLRGLMSHMVYADK
PDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSATMARPDLTFDLVRPGIAVYGLSP
VPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWIAPRDTNLALLPIGYADGVFRSL
GGRLEVLINGRRRPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRGEPTAQDWADL
VGTIHYEVVTSPRGRITRTYREAENR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtggatctg
ggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcagctgatg
gcggtggtcaaggccgacggctacggtcacggtgccacgcgcgtcgcccaaaccgccctg
ggcgccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctgcgcggt
gacggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttcgggccc
gcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaactgttg
gacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggataccgggctg
aaccgcaatggcgtgggacccgcacaattcccggccatgctgaccgcgttacgccaagcc
atggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgccgacaag
cctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcgcaggcc
cgcgaacaaggggtgcggttcgaggtggcgcatctgtcgaattcatcagcaactatggct
cgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggctaagcccg
gtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgctgttgcg
ctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacctggatcgcgcca
cgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccggtcgctg
ggcgggcggctggaggtgctgatcaacggcagacgacgccccggtgtggggcggatctgc
atggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggcgacgag
gcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggccgatctt
gtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccaggacctat
cgcgaggctgaaaaccggtga

DBGET integrated database retrieval system