KEGG   Mycobacterium canettii CIPT 140070010: BN42_90111Help
Entry
BN42_90111        CDS       T02421                                 

Gene name
ftsH
Definition
(GenBank) Membrane-bound protease FtsH (Cell division protein)
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Brite
KEGG Orthology (KO) [BR:mcx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcx01002]
    BN42_90111 (ftsH)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcx03110]
    BN42_90111 (ftsH)
Enzymes [BR:mcx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BN42_90111 (ftsH)
Peptidases and inhibitors [BR:mcx01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   BN42_90111 (ftsH)
Chaperones and folding catalysts [BR:mcx03110]
 Other chaperones and cochaperones
  AAA proteases
   BN42_90111 (ftsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 FtsH_ext AAA_5 AAA_16 RuvB_N TIP49 AAA_22 AAA_33 IstB_IS21 Mg_chelatase TsaE AAA_24 AAA_28 AAA_25 AAA_2 AAA_17 Sigma54_activat AAA_18 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CCK61750
LinkDB All DBs
Position
complement(4163609..4165891)
Genome map
AA seq 760 aa AA seqDB search
MNRKNVIRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAIAQINGDNVKSAQIDDREQ
QLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNAKVSTVVNQGSILGELLVYVL
PLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKD
FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVG
ASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGL
AKRTVGMTGADLANVINEAALLTAREHGTVITGPALEEAVDRVIGGPRRKGRIISEQEKK
ITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFA
MGGRAAEELVFREPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGTEHGDPFLGRTM
GTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ
AAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGAPAGWHAPGWPPRSSHRPSYS
GEPAPTYPGQPYPTGQADPGADESSAEQDDEVSRTKPAHG
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaaaacgtgattcgcaccataacagcgatcgccgtcgtggtgctgctcggc
tggtcgttcttttacttcagcgacgacacccgcggctacaagcccgtcgatacctcggtg
gcaatagcacagatcaacggcgacaacgtcaagagcgcacagatcgacgatcgcgagcaa
cagctgcggttgatcctgaagaagggtaacaacgagaccgacgggtccgagaaggtcatc
accaagtaccccaccgggtacgccgtcgacctgttcaacgcgctcagcgccaaaaacgcg
aaggtcagcacggtcgtcaaccaaggcagcatcctgggcgagctgctggtctacgtgctg
ccgctgctgttgctagtggggctgttcgtgatgttctcccgcatgcaaggcggcgcccgg
atgggcttcgggttcggcaagtcacgcgccaagcaactgagcaaggacatgcccaagacc
accttcgccgacgtcgcgggcgtcgacgaggcggtcgaggagctctacgagattaaggac
ttcctacagaaccccagcagataccaagcgctgggcgccaagatccccaaaggcgtgctg
ctctacgggccgccgggaaccggtaagacgttgctggctcgtgcggtggccggcgaagcc
ggagtgccgttcttcaccatctccggctccgacttcgtcgaaatgttcgtcggcgtcggt
gcatctcgcgtcagagatctattcgagcaggccaagcagaacagcccgtgcatcatcttc
gtcgacgagatcgacgccgtcggccgacaaagaggcgccgggctgggcggcggtcacgac
gagcgtgagcagaccctcaaccagttgctggtcgaaatggacggttttggcgatcgcgcc
ggcgtcatcctgatcgcggccaccaaccggcccgacatcctggacccggcgctgttgcgg
ccgggccgcttcgaccgccagatcccggtatccaaccccgacctggcgggtcggcgggcg
gtgctgcgcgtgcactccaagggcaagccaatggccgcggacgccgacctcgacggactg
gccaagcggaccgtcggcatgaccggcgccgacctggccaacgtcatcaacgaggcggcg
ctgctgaccgcccgagagcacggcaccgtcatcaccggtcccgccctcgaggaagcggtg
gaccgggtgatcggcggcccgcgccgtaaaggccggatcatcagcgagcaggagaagaag
atcaccgcctaccacgagggcgggcacaccctggccgcttgggcgatgcccgacatcgag
ccgatttataaggtgacgatcctggcgcgcgggcgtaccggcgggcacgcggtggcggtg
ccggaagaagacaagggcctgcggacccgctcggaaatgatcgcgcaactggtgttcgcg
atgggtgggcgcgccgccgaagaactggtgtttcgtgagccgaccaccggcgcggtgtcc
gacatcgagcaagccaccaagatagcgcgctcaatggtcaccgaatttgggatgagctcc
aagctgggcgcggtcaaatacggcaccgaacacggcgacccgttcctcggacgtaccatg
ggcacccagccggactactcccacgaggtcgcccgcgagatcgacgaagaggtccgtaag
ctcatcgaggcggcgcacaccgaagcgtgggaaatacttaccgaataccgcgacgtgctg
gacactttggccggcgagctgctggaaaaggagaccctgcaccgacccgagctggaaagc
atcttcgctgacgtcgaaaagcggccgcggctcaccatgttcgacgacttcggtggccgg
atcccatcggacaaaccgcccatcaagacacccggcgagctcgcgatcgaacgcggcgaa
ccttggccccagccggtccccgagccggcgttcaaggcggcgattgcgcaggctacccaa
gccgctgaggccgcccggtccgacgccggccaaaccgggcacggcgccaacggttcgccc
gccggcacccaccggtccggtgaccgccagtacggctccacccagcctgactacggtgcc
ccggcgggctggcatgcgccgggatggcccccaaggtcatctcatcggcccagctatagc
ggtgaaccggcaccgacgtatccgggtcagccctacccgaccggtcaagccgatccgggt
gccgatgagtcctcggcggagcaggacgacgaggtcagtcggaccaagccggcccacggc
tga

DBGET integrated database retrieval system