KEGG   Mycoavidus cysteinexigens: MCB1EB_0801Help
Entry
MCB1EB_0801       CDS       T05801                                 

Definition
(GenBank) amidase protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mcys  Mycoavidus cysteinexigens
Pathway
mcys00970  Aminoacyl-tRNA biosynthesis
mcys01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCB1EB_0801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcys03029]
    MCB1EB_0801
Enzymes [BR:mcys01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MCB1EB_0801
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MCB1EB_0801
Mitochondrial biogenesis [BR:mcys03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MCB1EB_0801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BBE08962
UniProt: A0A2Z6EU79
LinkDB All DBs
Position
complement(948696..950069)
Genome map
AA seq 457 aa AA seqDB search
MKTVRGMALALQNQQITSVRLIEEALARIDAHRRAGGCAWISVDAEHALVAAHASDVARA
AGYAPSLLAGLPISIKDLFDIAGQVTRAGSRILANAPPATTDALAVARLRAAGAILLGRT
NMSEFAYTGLGLNPHYGNPCTPLDPSRVAGGSSSGAAVSVAGEMAIAALGTDTGGSIRVP
AAFCGLTGFKPTAKRVPLTGAIPLSASLDSAGPLAPSVDCCAILDAVLVGQSPSSIETSA
ANIKGLRLYVTHDYVGAELDRTVHSAFEAALEALSRAGAHIVHFSFPELFELNSINQQGG
LVAAEAWTWHRSLIQRAGANYDPHVVANLRKGATLTAADYLDILAGHKRLQAYARQRLYD
ADAWLMPTAAITPPPLAPLIRDDALFVSTNKLALRNARITNILNGCALTLPCQLPGELPV
GLSICGFAYSDARIIRIARAIEAVLATRQHSTHLSTH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgttcggggtatggcgctggccttgcaaaaccagcagataacaagcgtacgc
ctgatcgaggaagcactcgcacgcatcgacgctcatcgtcgcgcaggcggctgcgcctgg
atcagcgttgacgcagaacatgcgttagtcgccgcgcatgcttccgatgttgcgcgggct
gctggttatgcgccttcgctcttggccggactaccgatttcgattaaagatttgttcgat
atagctgggcaagtgacccgcgccggttcgcgcattttagcgaatgcgccgccagcaacc
accgatgccctagcagtggcgcgcctacgcgcggcaggcgcgattctgctaggccgtaca
aatatgagcgaatttgcttatactgggcttggccttaatccacattacggcaacccctgc
actccgctggaccctagccgggtggcgggaggatcaagctccggcgccgccgtttcagta
gcgggtgaaatggccattgccgcactcggcacggataccggcggctcaattcgagtaccc
gcagcgttctgcggattaacaggctttaagccaaccgccaagcgcgtccctctgaccggc
gcgatccccctgtcggcttcgcttgactcggctggaccgctcgccccttcagttgactgc
tgcgccatcttagatgcggtactagtcggccaatccccctcttcgattgaaaccagcgca
gccaatattaaaggcttgcgcctttatgtcacgcacgattacgtaggcgcagagctggac
cgaacagtacactcagcttttgaggcggcactcgaggcgctaagccgagcaggtgcgcac
atcgtccatttttctttccctgaattatttgaacttaactcaatcaatcagcaaggcggt
ctggttgccgccgaagcctggacttggcaccgatcacttatacagcgcgctggcgcaaat
tatgaccctcacgtcgtcgctaaccttcgcaagggcgcaaccctcaccgccgctgattat
ctggatatactagccggacacaaacgcctacaagcctacgcccgccagcgcttatatgat
gcggatgcgtggctcatgcccactgcagccattacgccgccaccacttgcgcctctgatc
cgcgacgatgctttatttgtttcaaccaataaactggccttgcgcaatgcgcgcatcacg
aatattttgaatggctgcgcgctcacgctaccttgccaattgcccggtgaactaccggtc
ggattatcgatttgcggttttgcctatagcgatgcgcgcatcatccgcatcgcgcgcgcg
atcgaagccgtactggccacccgccagcactcaactcaccttagcacgcattga

DBGET integrated database retrieval system