KEGG   Mycoavidus cysteinexigens: MCB1EB_0860Help
Entry
MCB1EB_0860       CDS       T05801                                 

Definition
(GenBank) 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mcys  Mycoavidus cysteinexigens
Pathway
mcys00061  Fatty acid biosynthesis
mcys00780  Biotin metabolism
mcys01100  Metabolic pathways
mcys01212  Fatty acid metabolism
Module
mcys_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MCB1EB_0860
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MCB1EB_0860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mcys01004]
    MCB1EB_0860
Enzymes [BR:mcys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MCB1EB_0860
Lipid biosynthesis proteins [BR:mcys01004]
 Fatty acid synthase
  Component type
   MCB1EB_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: BBE09021
UniProt: A0A2Z6EUD5
LinkDB All DBs
Position
1034776..1035240
Genome map
AA seq 154 aa AA seqDB search
MSTQDIQLDIHRILTLLPHRYPILLVDRVLELEPHKRIKALKNVSINEPYFTGHFPACPV
MPGVLILEALAQAAGLLTFAEEEYDPAKSLYYFVGIDNARFKRPVEPGDQLILKVEFERH
LRGIWKFNACAEVDGAVAAEANLMCTVKPVADKS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccaagacattcaactcgatatccaccggattctgactttattgccgcatcgt
tacccgattttgctggttgatcgggttttagagctcgagccgcataaacgcattaaagcg
ctgaaaaatgtatctatcaatgagccttattttactggtcattttccggcttgcccggtt
atgcccggggtattaatcctagaagcattggcccaggcggccgggcttttaacgtttgcc
gaagaagaatatgacccggctaaatcgctttactattttgtcgggattgataatgcgcgt
tttaaacggccggtcgaaccgggcgatcaattaattttgaaagtggaatttgagcgccat
ttgcggggcatttggaaatttaacgcatgtgctgaagtagatggcgccgtggcggctgaa
gcgaatttaatgtgtacggttaaacccgtggcagataagtcctaa

DBGET integrated database retrieval system