KEGG   Mycoavidus cysteinexigens: MCB1EB_0946Help
Entry
MCB1EB_0946       CDS       T05801                                 

Definition
(GenBank) uracil-DNA glycosylase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mcys  Mycoavidus cysteinexigens
Pathway
mcys03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MCB1EB_0946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcys03400]
    MCB1EB_0946
Enzymes [BR:mcys01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     MCB1EB_0946
DNA repair and recombination proteins [BR:mcys03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MCB1EB_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BBE09107
UniProt: A0A2Z6EUH6
LinkDB All DBs
Position
1162929..1163681
Genome map
AA seq 250 aa AA seqDB search
MPEPDSILEELGLTPVWRTRTASTIGAAESAAAEACPSVDVKAPKKEFEVISEPISEVSE
TPISLLDWDTLKARVANCTRCRLCEKRNHTVFGIGDEKASWMLVGEAPGANEDRLGEPFV
GQAGKLLDNMLGAVGRTRENGIYIANVIKCRPPGNRDPQLDEVAQCEPYLKRQLAIIRPQ
LILALGRFAAQSLLKTDASISSLRTRVHQYEGVPVIVTYHPAYLLRNLPDKAKAWADLCR
AQEIYQAMNH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccggattcgatcctggaagaactaggtttgacgcctgtttggcgaacgcgc
accgcgagtacaataggcgcggctgaatctgctgcggccgaagcgtgcccaagcgtagac
gttaaagcgccaaaaaaagaatttgaggttatctctgaaccgatctcagaggtttctgaa
acccctattagcctgcttgattgggacactcttaaagcacgtgttgccaattgcacgcgt
tgccggttatgtgaaaaacgcaaccacaccgtatttggcattggcgatgaaaaggctagc
tggatgttggtaggcgaggcgcctggcgccaatgaagatcgcttaggagagccttttgta
gggcaggccggcaagctgctagataatatgttgggcgcagtagggcgcacgcgtgaaaat
ggcatctatattgcgaatgtgatcaaatgccgcccgcctggcaatcgcgatcctcaactt
gatgaggtggctcaatgcgagccgtatctaaaacgacagttggcgatcatccgcccgcaa
ctcattctcgcgcttggccgctttgctgcgcaaagcttactcaaaaccgatgccagtatt
tcatcgctccggactcgcgtgcatcaatatgaaggcgtgccagtgattgtgacttaccat
ccagcttatttattgcgtaacttacctgataaagcgaaagcatgggcagacctatgccga
gcgcaagagatttatcaagccatgaaccattag

DBGET integrated database retrieval system