KEGG   Mycobacterium canettii CIPT 140070017: BN45_100121Help
Entry
BN45_100121       CDS       T02422                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase 1 FolP (DhpS 1) (Dihydropteroate Pyrophosphorylase 1) (Dihydropteroate Diphosphorylase 1)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00790  Folate biosynthesis
mcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN45_100121 (folP)
Enzymes [BR:mcz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BN45_100121 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CCK65842
LinkDB All DBs
Position
complement(4161579..4162421)
Genome map
AA seq 280 aa AA seqDB search
MSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRV
DPAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLL
AEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGL
GFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI
SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccggcgcccgtgcaggtgatgggggttctaaacgtcacggacgactctttctcg
gacggcgggtgttatctcgatctcgacgatgcggtgaagcacggtctggcgatggcagcc
gcaggtgcgggcatcgtcgacgtcggtggtgagtcgagccggcccggtgccactcgggtt
gacccggcggtggagacgtctcgtgtcatacccgtcgtcaaagagcttgcagcacaaggc
atcaccgtcagcatcgataccatgcgcgcggatgtcgctcgggcggcgttgcagaacggt
gcccagatggtcaacgacgtgtcgggtgggcgggccgatccggcgatggggccgctgttg
gccgaggccgatgtgccgtgggtgttgatgcactggcgggcggtatcggccgataccccg
catgtgcctgtgcgctacggcaacgtggtggccgaggtccgtgccgacctgctggccagc
gtcgccgacgcggtggccgcaggcgtcgacccggcaaggctggtgctcgatcccgggctt
ggattcgccaagacggcgcaacataattgggcgatcttgcatgcccttccggaactggtc
gcgaccggaatcccagtgctggtgggcgcttcgcgcaagcgcttcctcggtgcgttgttg
gccgggcccgacggcgtgatgcggccaaccgatgggcgtgacaccgcgacggcggtgatt
tccgcgctggccgcactgcacggggcctggggtgtgcgggtgcatgatgtgcgggcctcg
gtcgatgccatcaaggtggtcgaagcgtggatgggagcggaaaggatagaacgcgatggc
tga

DBGET integrated database retrieval system