KEGG   Mycobacterium canettii CIPT 140070017: BN45_10019Help
Entry
BN45_10019        CDS       T02422                                 

Gene name
pknA
Definition
(GenBank) Transmembrane serine/threonine-protein kinase a PknA (protein kinase a) (STPK A)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcz01001]
    BN45_10019 (pknA)
Enzymes [BR:mcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BN45_10019 (pknA)
Protein kinases [BR:mcz01001]
 Serine/threonine kinases: Other
  Bacterial family
   BN45_10019 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: CCK62083
LinkDB All DBs
Position
complement(17759..19054)
Genome map
AA seq 431 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRA
EARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVI
KAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTERGETRHSGLQSWVVPPTPHS
RASLARYEIAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgagttggcgtgacgctgtcgggcagataccgcctgcagcgcctcatcgcc
accggtggtatgggccaagtctgggaggccgtggataaccggttgggccggcgtgttgcg
gtgaaggtgctcaagagcgagttctcctccgatccggagttcatcgaacggttccgggcc
gaagcgcgcaccaccgcgatgctgaaccatccgggcatcgccagcgtgcacgactacggc
gaaagccagatgaacggggagggtcgcacggcctacctggtgatggagctggtcaacggc
gagccactaaattcggtgctcaaacgcaccggccggctgtcgttgcggcacgcactggac
atgctcgagcagaccggccgcgctctgcagatcgcgcatgccgctggcctggtgcaccgc
gacgtcaaaccgggcaacatcttgatcacccccaccgggcaggtgaagatcaccgacttc
ggcatcgccaaagccgtcgatgcagcgcccgtgacccagaccggcatggtgatgggcacc
gcccaatacatcgcgccggagcaggccctcggtcacgacgccagcccggccagcgacgtc
tattcactgggagttgttgggtatgaagcggtttcgggtaaacggccgttcgccggcgat
ggtgccctgaccgtggcaatgaagcacatcaaggagccgccgccgccgctgcctcccgac
ctgccgcccaatgtgcgagaactcatcgagataactctggtgaagaaccccgcgatgcgc
tatcgcagtgggggaccgttcgccgacgcggtggcagcggtgcgcgccggccgccggccc
ccgcggcccagccagacacccccccctggccgggccgccccggcggccattccgtcgggt
acgacagccagggtcgcggccaactctgctggccggactgcggcatcccgtcgatcccgc
ccggccacgggtggtcaccggccgccgcggcgcacgttttcgtccggtcagcgtgcgctg
ctctgggccgcgggggtgctgggggcgctggcaatcatcatcgccgtgctgctcgtcatc
aaagcgcccggggacaacagcccgcagcaggcaccgacgccgaccgtgaccaccaccggg
aaccctccggccagcaacactggcgggactgatgctagcccgcgactcaattggacggaa
cgcggggaaacacgtcattctggactgcaaagctgggttgtcccgccgacaccgcattcg
cgcgcgtcgctggcccgatacgagatagcgcaatga

DBGET integrated database retrieval system