KEGG   Mycobacterium canettii CIPT 140070017: BN45_10272Help
Entry
BN45_10272        CDS       T02422                                 

Definition
(GenBank) Putative succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00020  Citrate cycle (TCA cycle)
mcz00190  Oxidative phosphorylation
mcz00650  Butanoate metabolism
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
Module
mcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN45_10272
   00650 Butanoate metabolism
    BN45_10272
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN45_10272
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN45_10272
    1.3.5.4  fumarate reductase (quinol)
     BN45_10272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CCK62324
LinkDB All DBs
Position
complement(299920..301860)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAIDAAAQQALSPFEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWARYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRKILLVCRAAETMGTGGSGAG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagacccacttcggcgacacgatgcgcggtggaaagttc
ctgaataactggcggatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctcgagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaagaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggtgcgatcgccggagccttcggctactggcgggaaagcggccggttcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggatcggcaagtccttcaaggtgacatcc
aactcctgggagtacaccggagacgggcacgcattggcactgcgggccggggcgacgctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgaaggcgttcgcggtgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtacgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacctgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccagggctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcactgagcagccggcctgcggtttcagcggaggct
atcgatgcggcggcccagcaggcgctgagccccttcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgcttcatatggacttgcagtacgtgatgaacgatctggtaggt
atcatccgtaacgccgacgaaatatccagggcgctgactcttttggccgagctgtgggcg
cgctaccacaacgtgctcgtcgaaggtcaccgccaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctgcagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aagatcttgctggtatgccgggccgcggaaaccatgggcaccggtggcagcggggccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaagtactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system