KEGG   Mycobacterium canettii CIPT 140070017: BN45_50980Help
Entry
BN45_50980        CDS       T02422                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT (gamma-amino-N-butyrate transaminase) (GABA transaminase) (glutamate:succinic semialdehyde transaminase) (GABA aminotransferase) (GABA-AT)
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00250  Alanine, aspartate and glutamate metabolism
mcz00280  Valine, leucine and isoleucine degradation
mcz00310  Lysine degradation
mcz00410  beta-Alanine metabolism
mcz00640  Propanoate metabolism
mcz00650  Butanoate metabolism
mcz01100  Metabolic pathways
mcz01120  Microbial metabolism in diverse environments
Module
mcz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN45_50980 (gabT)
   00650 Butanoate metabolism
    BN45_50980 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN45_50980 (gabT)
   00280 Valine, leucine and isoleucine degradation
    BN45_50980 (gabT)
   00310 Lysine degradation
    BN45_50980 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN45_50980 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcz01007]
    BN45_50980 (gabT)
Enzymes [BR:mcz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN45_50980 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BN45_50980 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     BN45_50980 (gabT)
Amino acid related enzymes [BR:mcz01007]
 Aminotransferase (transaminase)
  Class III
   BN45_50980 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCK64773
LinkDB All DBs
Position
3019238..3020587
Genome map
AA seq 449 aa AA seqDB search
MASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATDGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLGWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIKRARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctgcagcagagtcggcgcctggtcaccgaaatccccggtcccgcatcgcag
gcactgactcaccgccgggcggcggcggtgtccagcggtgttggggtcaccctgccggtg
ttcgtagcccgcgccggcggcggcatcgtggaagacgtggacggtaaccggctcatcgac
ctgggttcgggcatcgcagtgacgacgatcggcaactcgtcgccacgcgtggtggatgcg
gtgcgcacgcaggtggccgaatttacccacacctgcttcatggtgacgccatacgagggg
tacgtggccgtcgccgagcaactcaaccggattaccccaggttcgggccccaagcgctcg
gtgttgttcaattccggcgccgaggcagtcgagaacgccgtcaagatcgcacgctcctac
accggcaagcccgcggtggtggcgttcgaccacgcctaccacggtcgcaccaacctaacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgccggag
atctaccgagcgccattgtcttacccctatcgggacggcctcctcgataagcaactggct
accgatggtgagctagccgcggcccgagccatcggcgtcatcgacaagcaggtaggcgcg
aacaacctggccgccctcgtcatcgaaccgatccagggcgaaggcggtttcatcgttccg
gccgaagggttcctacctgccctcctcggttggtgccgcaagaaccatgtggtgttcatc
gccgacgaggtgcaaaccggctttgcccgtaccggggcgatgttcgcctgcgagcacgag
ggccccgacggtctagagcccgacctgatctgcacggccaaaggcatcgccgatggattg
ccgctgtcggcggtcaccggccgcgccgagatcatgaacgccccgcacgtgggcggtctg
ggcggcacgttcggcggcaatccggtggcctgtgcggccgcgctggccaccatcgcaacc
atcgaaagcgacgggctgatcaagcgggcccgccagatcgaacgcctggtgaccgaccgg
ttgacgacgctgcaggccgtcgacgaccggatcggcgacgtgcgtggtcgcggcgccatg
atcgccgtagagctggtcaaatccggaaccaccgagcccgacgccgggctgactgagcgg
ctggcgaccgcggcccacgccgccggcgtcatcattttgacctgcggcatgttcggcaac
atcatccggctactgccgccgctgaccatcggcgacgagctgctgagtgaggggctggac
atcgtgtgcgcgatcttggccgacctctga

DBGET integrated database retrieval system