KEGG   Mycobacterium canettii CIPT 140070017: BN45_51395Help
Entry
BN45_51395        CDS       T02422                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00473  D-Alanine metabolism
mcz00550  Peptidoglycan biosynthesis
mcz01100  Metabolic pathways
mcz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN45_51395 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN45_51395 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN45_51395 (ddlA)
Enzymes [BR:mcz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN45_51395 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mcz01011]
 Precursor biosynthesis
  Amino acid ligase
   BN45_51395 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CCK65157
LinkDB All DBs
Position
complement(3430425..3431546)
Genome map
AA seq 373 aa AA seqDB search
MSANDRRDRRVRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFDVIAVGITPAGSWVLTD
ANPDALAISNRELPQVKSGSGTELALPADPRRSGQLVSLPPGAGEVLESVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLH
RQECERLGLPVFVKPARGGSSIGVSRVSSWDQLSAAVARARRHDPKVIVEAAISGRELEC
GVLEMPDGTLEASTLGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQ
LAIRAFAAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MIETALARGVGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctaacgaccggcgtgatcggcgtgtccgcgttgccgtcgtgttcggcgggcgc
agcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctgcgcaacctggacccg
cggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcgtgggtgctcaccgac
gccaaccccgacgccctggcgatcagcaaccgggagttgccgcaggtcaaatcaggatcg
ggcaccgagctggcgctgccggccgatccgcggcgtagtggccagttggtgtcgctgccg
cccggggccggcgaggttctggagtcggtcgacgtggtgttcccggtactgcacggcccg
tacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctacgtgggc
gccggtgtgctggccagcgccgtcggcatggacaaggagttcaccaagaagctgctcgcc
gccgatggacttccggtgggtgcgtacgcggtgctgcgcccgccgcggtcgacactgcac
cgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccggggcggctcg
tcgatcggtgttagccgggtgtcgagttgggatcaactgtccgccgcggtcgcgcgggcc
cgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctggaatgc
ggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatccgggtg
gccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctcgacgac
gcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgattcgtcag
ctggcgatccgggcgttcgcggctatcgactgccagggtctggccagggtggacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgacgctgctggcgacg
atgatcgagacggcattggcccgcggtgtgggcctgcgctag

DBGET integrated database retrieval system