KEGG   Mycobacterium canettii CIPT 140070017: BN45_60360Help
Entry
BN45_60360        CDS       T02422                                 

Gene name
sdhB
Definition
(GenBank) Putative succinate dehydrogenase (iron-sulphur protein subunit) SdhB (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00020  Citrate cycle (TCA cycle)
mcz00190  Oxidative phosphorylation
mcz00650  Butanoate metabolism
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
Module
mcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN45_60360 (sdhB)
   00650 Butanoate metabolism
    BN45_60360 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN45_60360 (sdhB)
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN45_60360 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BN45_60360 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_15 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: CCK65537
LinkDB All DBs
Position
3824547..3825338
Genome map
AA seq 263 aa AA seqDB search
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLN
LLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVE
PIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCA
CCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTE
SCPRGIEVTKAIQEVKRALMFTR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagccggacgtcgaaactttggatccgcccctaccgccggtaccggacggc
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgacgaccccgacgcgttcgcg
gccaccggcggctggcagagcttccgggtgccctgtttgcccagcgatcggctgctcaac
ctgctcatctacatcaagggctacctcgacggcacgctcaccttccggcgatcctgcgcc
catggggtgtgcggctctgatgccatgcgcatcaacggggtgaaccggctggcctgcaag
gtgctgatgcgcgacctgctgccgaagaagaagggcaaatcgttgaccgtcacggtcgag
ccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggagccgttcttcgac
gcctaccgggcgatcaaaccgtacctgatcaccagcggcaacccgcccacccgcgaacgg
atccagagcccgaccgaccgcgcccgctacgacgacaccaccaagtgcatcctgtgcgcg
tgctgcaccaccagctgcccggtgttctggcacgagggcagctacttcggcccggcggcg
atcgtcaacgctcaccgcttcatcttcgacagccgcgacgaggccgccgccgagcgcctc
gacatcctcaacgaggtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgaa
tcctgcccacggggcattgaggtgaccaaggcgatccaggaggtcaagcgcgcgctgatg
ttcacccgctga

DBGET integrated database retrieval system