KEGG   Mycobacterium canettii CIPT 140070017: BN45_60362Help
Entry
BN45_60362        CDS       T02422                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcz  Mycobacterium canettii CIPT 140070017
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 DUF4129
Motif
Other DBs
NCBI-ProteinID: CCK65539
LinkDB All DBs
Position
complement(3825849..3826091)
Genome map
AA seq 80 aa AA seqDB search
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQAAASQEDAFHGFEPLP
HRGGAVSNALIDRLRDEEAV
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccacgttgtccatcgacgacgatgtattgctggccgtgaaggaacgggcacgc
agggagaagcgcaccgcgggtgaaatcctgtcggatctggcccggcaagcgttaaccaac
cagaatccccaggctgcggcgagccaggaggacgcctttcatggcttcgaacccctgcct
catcgcggtggagcggtatcgaacgcgctaatcgatcggcttcgtgacgaggaggccgtg
tga

DBGET integrated database retrieval system