KEGG   Musca domestica (house fly): 101887292Help
Entry
101887292         CDS       T03448                                 

Definition
(RefSeq) histone-lysine N-methyltransferase E(z) isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mde  Musca domestica (house fly)
Pathway
mde00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mde00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101887292
Enzymes [BR:mde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101887292
Chromosome and associated proteins [BR:mde03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101887292
   Polycomb group proteins
    PRC2-EZH2 complex
     101887292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Mem_trans
Motif
Other DBs
NCBI-GeneID: 101887292
NCBI-ProteinID: XP_005184702
UniProt: A0A1I8MV84
LinkDB All DBs
Position
Unknown
AA seq 773 aa AA seqDB search
MTNNLKVPLEWKRRVKKEYMKIRQQKRYKRADEIKEAWIKNWDEHNYNVQDLYCEPKVWQ
AQPYDPPHVDCVKRAEVTIYNGGGTQQVPICVINAVTPIPTMYTWAPTQQNFMVEDETVL
HNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDSIFVELVHALMRTYPKEIEE
ITGAPLKIEVIKNDEIKDMQKNEDKDASTSEKEKNEKQIDSENDVKDAKILEEGEKIIAE
KNSNDEKDIASGESTEKTTTDNLTEKLPFPPPIIFQAISSNFPDKGTSQELKEKYIELTE
HQDPERPQECTPNIDGEKAESVSRERTLHSFHTLFCRRCFKYDCFLHRHPTHGFQVGHSG
PNLQKRRFPEMKPFTEPCSNNCYMLLEGMKEKLAADNKTPPIDSCNEASSEDSNDSNSQF
SNKEFNNDQTKENGTVTSAASAEINSIMAGMMNTSNVKCDWTGADQSLFRTLHKVFLKNY
CAIAQIMLTKTCEQVYEFAQKEASEFSIEELRQDYTPPRKKKKKQRLWSLHCRKIQLKKD
SSSNHVYNYTPCDHPGPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCP
CYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDVAGWGIFLKEGAQ
KNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINP
NCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataatctgaaagtaccgttggaatggaagagacgtgttaaaaaggaatatatg
aaaattcgacagcagaaaagatacaaaagggcggatgaaataaaggaagcatggataaag
aattgggacgaacacaattacaatgttcaagatctgtattgtgagccgaaggtttggcag
gcccaaccatatgatccaccgcatgtggactgcgtcaaaagagcagaagtgacaatttat
aacggaggtggtacccaacaagtgccaatatgtgtaataaatgctgtcacgcctattcca
acaatgtacacatgggcccccactcagcaaaatttcatggttgaagatgaaaccgtcctc
cacaatattccctatatgggtgatgaagtactcgataaggatggtaaatttattgaggaa
ttgataaagaattatgatggcaaggtacatggcgataaagatccctcatttatggacgat
tcaatatttgtggagctagtgcacgcgttaatgagaacatatccaaaagaaattgaagaa
attactggcgctcccttaaaaattgaagtaataaaaaatgatgagataaaggatatgcag
aaaaacgaggataaggatgcaagtactagcgaaaaagaaaaaaatgaaaagcaaatagat
tctgaaaatgatgtcaaagatgcaaaaattcttgaagaaggtgaaaaaatcatagccgag
aagaatagcaatgatgaaaaagacattgcatctggcgaaagtacagaaaagacgactaca
gataatcttacagagaaacttcctttccctcctccgataatatttcaagccattagctca
aattttcccgacaaaggaacgtcgcaggaactcaaagaaaaatacattgagttgacagaa
caccaagatccagagcggccgcaggaatgtacaccaaatattgatggtgaaaaggcagaa
agtgtttcacgtgaaagaacacttcattctttccatacattgttctgtaggcgttgcttc
aaatatgattgttttttacatcgtcatccaactcacggttttcaagtaggacattctgga
ccaaatttgcaaaaacgacgttttcctgaaatgaaaccatttactgaaccatgtagcaac
aattgttatatgctcctggaaggaatgaaggagaaactcgcagctgacaacaaaacaccg
ccaattgattcttgcaacgaagcaagttcggaagatagtaatgatagcaacagccagttc
agtaataaggagtttaacaatgaccaaactaaagaaaatggaactgtaacaagtgcagct
tctgcagaaataaattctataatggcgggaatgatgaatacctcgaatgtcaaatgtgac
tggactggagcggatcaatcgctatttcggactttacacaaagtatttctaaaaaattat
tgtgctattgcccagataatgttgaccaagacatgtgaacaggtgtatgaattcgcacaa
aaagaggcctctgaatttagcatcgaagaacttcgacaagattatactccacctcgtaag
aagaagaagaagcaaaggttgtggtcattgcactgtcgtaaaatacaactgaaaaaggat
tcctcttcaaatcatgtctataattatacaccttgtgaccatcccggtccttgtgacatg
aattgttcatgcatacagactcaaaacttttgcgaaaaattctgtaattgcagtagcgat
tgccaaaatcgttttccaggttgtcgctgtaaagcacaatgtaataccaaacaatgtcca
tgttatttggctgtacgtgaatgtgacccggatctttgtcaggcatgtggtgcagatcaa
tttaagcttacaaaaattacttgcaaaaatgtttgcgttcagaggggcctacataaacat
ttactcatggcaccctcagacgtcgccggttggggtattttcctaaaggaaggagcccag
aagaatgaatttatttcggaatattgcggtgaaataatatcacaggatgaggccgatcga
cgaggaaaagtttatgacaaatatatgtgttcattcttgtttaatttaaacaatgatttt
gtcgttgatgctacgcgcaaaggcaataaaatacgttttgcgaaccattccatcaatcct
aattgctatgccaaggtaatgatggtgaccggcgatcatcgaataggcatttttgctaaa
cgagccatacagcctggagaggagctgttctttgattatagatatggacctaccgaacaa
ttaaaattcgtaggtattgaacgtgaaatggaaattgtttaa

DBGET integrated database retrieval system