KEGG   Musca domestica (house fly): 101887297Help
Entry
101887297         CDS       T03448                                 

Definition
(RefSeq) vitellin-degrading protease
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mde  Musca domestica (house fly)
Pathway
mde04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mde00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101887297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mde01002]
    101887297
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mde04147]
    101887297
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101887297
Peptidases [BR:mde01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101887297
Exosome [BR:mde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101887297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Toxin_4
Motif
Other DBs
NCBI-GeneID: 101887297
NCBI-ProteinID: XP_005186019
UniProt: A0A1I8ML77
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MQLVATLTGPLTLVCLMAPILVVAGPSFGHRIVNGKIIHIADAPYTVQITDAFGLWICGG
TLVSDQFVVSAAHCFESRHPRELRVYAGANLREHYGSEGTEYRVSKLWNHPEYIFKHDPR
KVNEHMDVAVLKLAKPVEFGETVRAVRMCNKPLQAEELIRIVGWGRVEFRGEQSNELRSI
DVPVFSHEQCVAMHEDSVTKITHSMVCAGLPGDKDACQGDSGGPAIRKGELCGIVSWGVG
CADKNHPGIYTSIPVVRDFIDECMAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggttgccacattgacaggacctttaacacttgtgtgtttgatggcacccatc
ttggtcgttgcgggtcccagttttggtcatcgtattgtcaatggcaaaatcatacacatt
gccgatgctccttataccgtacaaattaccgatgcctttggtctttggatttgtggtggt
accttggtttccgatcaatttgttgtctcggccgcccattgttttgagagtcgtcatccc
agggaattgcgtgtttatgctggtgctaatcttcgtgaacattacggtagtgagggtacc
gaataccgggtctccaagctgtggaatcacccagaatatatcttcaaacatgatccacgc
aaggtcaatgaacatatggatgttgcggtactcaaactggccaaacctgttgagtttggt
gaaacggttcgtgcggtaagaatgtgcaacaaacctttacaagctgaggagttgatccgt
attgtgggttggggtcgtgtcgagttcagaggtgaacaatcgaatgaattgcgttccatt
gatgtgccggtattctcacatgaacagtgtgttgcaatgcatgaagattcggttacaaaa
attacccatagcatggtctgtgctggtctgcctggtgacaaggatgcctgccagggtgat
tccggcggtcccgccatacgtaagggagaattgtgcggcattgtgtcgtggggtgttggt
tgtgccgataagaatcatccgggaatttataccagcattccagtggtgcgtgattttatt
gatgagtgcatggctcagtag

DBGET integrated database retrieval system