KEGG   Musca domestica (house fly): 101888018
Entry
101888018         CDS       T03448                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101888018
   04215 Apoptosis - multiple species
    101888018
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101888018
NCBI-ProteinID: XP_005186111
UniProt: T1PC80
LinkDB
Position
Unknown
AA seq 310 aa
MPSPPSTPRIRNTPPFPPAPKLARAKLKSSSLDHEIFLTTTHSSRPKHHRPLQTSTSVEW
HHQHQAALTIPRTGSTSSLASSTFQYPLAGGSNYHDFKNEIINQGKCLCGQYIRARLRRA
GVLNRKVIQRMRSLLEPSSEIVYEVFPALNSMGEELERMHPRIYTNVSRQLSRAPYGELV
DSDTAPMLMNLVAKQLFSRSTAEKERITWAKIISVFAVCGGFAIDCVRQGHYDYLQCLVD
GVGEIIEDDLVHWLVERGGWMGLQQHIKPKGSQTFSFLDWLTLFVAISSSFYAVANFLKQ
LGCQMYSLIF
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccttcaccaccgtccaccccgcgtatacgcaatacaccgccattcccgccggcacca
aaattagcacgagccaaattgaaatcctcttcgctggatcatgaaatattcttgaccaca
acacacagcagccgacccaaacatcatcggccgttacagactagcacctcggtggaatgg
catcatcagcatcaagcggcactgaccataccgcgtactggatcaacatcatctctggcc
agcagtacattccaatacccgttggcgggcggtagtaattatcacgattttaaaaatgaa
attatcaatcagggaaaatgcctctgtggccaatacattcgggccagactaagacgagcc
ggtgtcttaaatcgcaaggtgatacagagaatgcgtagtctattggaaccatcctcagaa
attgtttatgaagtctttccggcactaaatagtatgggcgaagaactggaacgcatgcat
ccacgtatctatacaaatgtttcacgtcaactttcccgcgcaccctatggcgaactggtg
gatagcgatacagcgcccatgctaatgaatctggtggcgaagcaacttttctcacgtagc
accgccgagaaggaacgcatcacatgggcgaaaatcatttcagtctttgccgtgtgcggt
ggctttgccatcgactgtgtacgtcaaggtcactacgactatttgcagtgtttggtcgat
ggtgtgggtgaaataatcgaagatgatctagtccattggttggtggaacgtggcggttgg
atgggtctgcaacagcacataaaacccaagggttcacagacgttttcttttttagattgg
ctaacgctgttcgtggcgatctcgtcaagtttttatgccgtagcaaatttccttaaacag
ctgggttgtcaaatgtattcgttgatattttag

KEGG   Musca domestica (house fly): 101896788
Entry
101896788         CDS       T03448                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101896788
   04215 Apoptosis - multiple species
    101896788
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101896788
NCBI-ProteinID: XP_011295384
UniProt: T1PC80
LinkDB
Position
Unknown
AA seq 310 aa
MPSPPSTPRIRNTPPFPPAPKLARAKLKSSSLDHEIFLTTTHSSRPKHHRPLQTSTSVEW
HHQHQAALTIPRTGSTSSLASSTFQYPLAGGSNYHDFKNEIINQGKCLCGQYIRARLRRA
GVLNRKVIQRMRSLLEPSSEIVYEVFPALNSMGEELERMHPRIYTNVSRQLSRAPYGELV
DSDTAPMLMNLVAKQLFSRSTAEKERITWAKIISVFAVCGGFAIDCVRQGHYDYLQCLVD
GVGEIIEDDLVHWLVERGGWMGLQQHIKPKGSQTFSFLDWLTLFVAISSSFYAVANFLKQ
LGCQMYSLIF
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccttcaccaccgtccaccccgcgtatacgcaatacaccgccattcccgccggcaccg
aaattagcacgagccaaattgaaatcctcttcgctggatcatgaaatattcttgaccacg
acacacagcagccggcccaaacatcatcggccgttacagactagcacctcggtggaatgg
catcatcagcatcaagcggcactgaccataccgcgtactggatcaacatcatcgctggcc
agcagtacattccaatacccgttggcgggcggtagtaattatcacgattttaaaaatgaa
attatcaatcagggaaaatgcctctgtggccaatacattcgggccagactaagacgagcc
ggtgtcttaaatcgcaaagtgatacagagaatgcgtagtctattggaaccatcctcagaa
attgtttatgaagtctttccggcactaaatagtatgggcgaagaactggaacgcatgcat
ccacgtatctacacaaatgtttcacgtcaactttcccgcgcaccctatggcgaactggtg
gatagcgatacagcgcccatgctaatgaatctggtagcgaagcaacttttctcacgtagc
accgccgagaaggaacgcatcacatgggcgaaaatcatttcagtctttgccgtgtgcggt
ggctttgccatcgactgtgtgcgtcaaggtcactacgactatttgcagtgtttggtcgat
ggtgtgggtgaaataatcgaagatgatctagtccattggttggtggaacgtggcggttgg
atgggtttgcaacagcacataaaacccaagggttcacagacgttttcttttttagattgg
ctaacgctgttcgtggcgatctcgtcaagtttttatgccgtagcaaatttccttaaacag
ctgggttgtcaaatgtattcgttgatattttag

DBGET integrated database retrieval system