KEGG   Musca domestica (house fly): 101888199
Entry
101888199         CDS       T03448                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101888199
   04215 Apoptosis - multiple species
    101888199
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101888199
NCBI-ProteinID: XP_005186112
UniProt: A0A1I8MPR4
LinkDB
Position
Unknown
AA seq 305 aa
MSNSGPYSDNTQNGYGSSSSYGSNFLQPPGMNDRLPSIQSRRKFSFPATLHSANLLEVNQ
ISTRRRLSNVSDVVTRKLSYTIGWKGAQIPAQEIVSQGRCLCGQYIKRRLRRSGLFNKKL
GLQRIRSILGTSTMSVVREVFPAVMVLGDELERMHPRIYTGVARQICRNPGGEFQSADTV
ILLVSAVARELFRMEITWSKIVSLFAIAGGLSVDCVRQGHPEYLPKLMQSVSDVIEDELV
PWINENGGWVGINNHVHPATNKLNPLEWTTIIVGSIFGLVLIYMFIRFLVTNLVPKVYER
ITAGK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtccaattccggcccgtacagtgataacactcaaaatggttatggcagcagcagtagc
tatggttcaaattttctccaaccaccgggaatgaatgatcgattgcctagcattcaatcg
agaagaaaatttagttttcccgcaactctgcattccgccaatttgttggaagttaatcaa
atttcaactcgacggcgtttaagcaacgttagtgatgtggtcacaagaaagctgtcctac
accattggttggaagggtgcccagataccagcccaggaaattgtctcacagggacgttgc
ctttgtggtcaatacattaaacgacgtttgagacgatctgggctgttcaataaaaaattg
ggattgcaaaggatacgaagtattttgggcacctccaccatgtcggtggtgcgtgaggtg
ttccctgccgttatggtgctaggtgatgagttggaacgcatgcatcctcgcatttatacc
ggagtggcccgtcaaatttgtcgcaatcctggtggagaatttcaatctgccgacactgtc
atacttttggttagtgctgtggctcgtgaactatttcgtatggaaattacgtggagtaaa
atagtctcattgtttgccatcgctggaggtctgtctgttgactgtgttcgccaaggacat
cctgaatatttgccgaaattaatgcaaagcgtttctgatgtcattgaagatgaattggtg
ccttggattaatgaaaatggtggatgggttggcattaacaatcacgtacatccggcaacc
aataaactgaatcccttggaatggaccacaattattgttggcagtatttttggtttagta
ttaatttatatgttcattagatttcttgttactaatttagtaccaaaagtgtatgagaga
attacagcaggtaaataa

DBGET integrated database retrieval system