KEGG   Musca domestica (house fly): 101888223
Entry
101888223         CDS       T03448                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X2
  KO
K16679  wengen
Organism
mde  Musca domestica (house fly)
Pathway
mde04013  MAPK signaling pathway - fly
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
mde04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:mde00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101888223
   04391 Hippo signaling pathway - fly
    101888223
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101888223
   04215 Apoptosis - multiple species
    101888223
SSDB
Motif
Pfam: TNFR_c6 PhoR Comm Trp_oprn_chp LapA_dom Vpu PspB SPC25
Other DBs
NCBI-GeneID: 101888223
NCBI-ProteinID: XP_005191410
UniProt: A0A1I8M5U2
LinkDB
Position
Unknown
AA seq 396 aa
MKRHTPAHIPQRSTLTTATTTNSYNTTHVQQTPPSFSGSLARSRAELPVIESPTTVLSKQ
TSSNSYKEAEETDEEPLIVAVAKKKSTTQPLDGQQQHGTSNKSRRTRSSAAAFFWSRWSQ
HWSQLKPSTAACVSAFLLLSTTCSLCSASLCDPQSWWDPYKDKCIPCTVCQGDMIPLRPC
QMHRDTVCGSIYDLKIDWVVLAKTEPNWKERRKFDGSDYGLDHHQLTAEQLQQLQDETDP
MDWQTAALFLAVLACLLFFIVAACILVHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQS
LEGGTFFIGNADALRIQPSAPALQTTVAAFHQPQHVMLPEKSEKHHSHLLQSGQLGGQHH
HLQSPHDRHLFNTTTTNTLKSGNVYIEDGNGTGSKC
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaagagacacacacccgcgcatattccacaaagatcaactctaacaacagcaacaaca
acaaattcttacaatacaacacatgttcaacagacacctccctcgtttagtgggagcctg
gcccgaagtagagcagagctccccgttattgaatcacctactacagtgctaagcaaacaa
acatctagcaatagttacaaagaagcagaagagacggacgaagaaccgctcattgtggcc
gtggccaagaaaaaaagtacaacacaaccgctggatggccagcaacaacatggaacatca
aacaagtcgaggaggacaaggtcgtccgcggcagccttcttctggtcacgatggtcacaa
cactggagccaattgaagccatcgacagccgcctgcgtttcggcatttcttttgctctca
acgacatgttccttatgttcggcctccttgtgtgacccccaaagctggtgggatccctac
aaggataaatgcattccttgcactgtgtgccagggcgacatgataccgctgagaccgtgt
caaatgcatcgtgacaccgtttgtggttcgatatatgatttgaaaatcgattgggtggtg
ctggcgaaaaccgaacccaattggaaggagaggcgaaagtttgatggttccgattatgga
ttagaccaccatcagttgactgccgaacaattgcagcagctgcaggatgaaacggatccc
atggattggcagacggcagccttatttttggccgtnttggcctgtctgctgtttttcatt
gtggccgcctgtattctggtgcatcatatgcggcagtggcgacgcatggaacgtagatta
gatcaagatgtcgaagaactttcaaccaaactcatggccaaattggccgaggtacaaagt
ttggagggtggcacatttttcataggcaatgccgatgccctacggatacagccatctgca
ccagccctgcagacaacggtggcagcatttcatcagccccagcatgtcatgttaccagaa
aaatcggagaaacatcacagccacctccttcagtcaggccagctgggtggacaacatcat
catttgcagtcgccacatgaccgacatcttttcaatacaacaacaacaaataccctaaaa
tcgggcaatgtttatatcgaggatggaaatggaactggctcgaaatgctaa

DBGET integrated database retrieval system