KEGG   Musca domestica (house fly): 101889170
Entry
101889170         CDS       T03448                                 

Definition
(RefSeq) uncharacterized protein LOC101889170
  KO
K02084  apoptotic protease-activating factor
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101889170
   04215 Apoptosis - multiple species
    101889170
SSDB
Motif
Pfam: APAF1_C WD40 PTEN_C2
Other DBs
NCBI-GeneID: 101889170
NCBI-ProteinID: XP_011290922
UniProt: A0A1I8MQ21
LinkDB
Position
Unknown
AA seq 1504 aa
MSFHSRSSSEIDAIPYGEILQICIKDFEKDFDFADVKEKVRDCFTKTELDYIEKATGKEQ
IQHLIWVLVAKPDEIITQFLDGIVYDYKWIVEKIQSEVTNHSEKTELYLEKLRAIQSKNE
AHTQYNVHRTKPFMALGRKLRLLNPKKTYNSVVLLGDLGSGKKWLAIDVCSDFRVMKHMG
FNIFWIDCIYCTNPEEDYNALKQLMFKLNPDFNFNEIQCANIKDKISTLQVKIKHLLESK
EYKKCLLVLANVQNTKAESVFKLDCKRLIITRNQKIYDTLPDKVNLKMKLTEGLTLMEFH
TLLDKYIRKYKWREVNPEYASDIYYASNADPYILSIIARQLQYKRSNWDEWKKNLDTLQI
PDEKFRRDIENSLQLLTPEQLQLYATLSIFPHCAKIPVKLLANLWQKNLSDTEKIIEKLH
SKSFLEKELLSDDDTTVCSLRYIYSSYIKNCPSIQNLINAQQLHRAVIDYYKVEEHLDIR
IDVDLYFAPEHDNYFFQCLGYHLYGANYINLFQRLYMDFGFLGQKMRHVGLANTIADLKY
YKKEITLNCTSNIMDKLITFLAKVEEKLLHAPDCCLLQYALLANEEMIRQLASKQISQFP
RRMWFEETGRFHQRRFIHKLHSSCKIIRILDSDICIVVLHNNETHLVDISLDTLCSNVQL
IRESPVNIIDIKPFNDANHLLTLDSKGQLKLWKIYDEKRRMIAQRRNSASKFNLGEYKFC
RQQIASCTFQQCINDDIMGLRHIVAFYMESPDNKLHVALDNGDIIVFDWTHEEFRTNHFY
VPFKTDIVDIKCICKINCTHYMILHGSTETPVDITFINLRNTGKENINFDWPRVLKNFIY
YEVCGDCILMVYQNAIVRLSPSFYPGYVGGSIEVLFEDNNFNINCAKYSLKYNYLMVGSN
PGLHVFDLSKPVKVLESIVSENVTSIDIYDLDDEEYKCMVTCGIERKTIIYLLGLCKAAD
KLDWQHNRAHSNQLVGEQRSAIRFKGKRMFDVATYGGQSYLYAIDSENRIHQISTSDAKN
WNILKIPNLTLPQITAICCQGDKAFVAIKSQGIYDLHQHKYVGELQKSVVVNNLRLIHGD
TLIATSDSNTHIIILNNNSGLCQQRIDFVAKFCYAFLDNHYMLVNAFGSIVFVARDLKHF
NIGTEALNGLADCDLKAGMVFLGFKDFQVEIYALRANGSNVECKSLYSHQESNCQITCLT
ASSNGKLFAVGLNTSPQAQTSEHCMMPNHDLKTANNNTPVSCGDINVYKLNNTDDKFTAD
KIFCLKSHTSPVHDLHFSPQADVLVSVSGQICFWNISYVLNNPLTANTKKRHSSRFSSQR
SAEEVDATHVLTRNRNMKAVFRSEMKKSFCKSLSLQASSFDSDGNSDGEVFESEVKQMQQ
QQQTEESFWQYLTGPEDKAELLSCYKLDGNEAMQLFANHDFSQFYTIDDEGVYYNLNIIQ
QPSKSPILKEDSPDTVDLGDYSSRSGSEASADTENGNTLYKDMDRRLSLSSSASGRDVVD
NYQA
NT seq 4515 nt   +upstreamnt  +downstreamnt
atgagcttccacagtcgcagttctagtgaaatagacgccataccatatggtgagatcctg
cagatatgtatcaaggattttgaaaaagatttcgattttgccgatgtcaaggaaaaagta
cgtgattgtttcacaaaaacggagttggactatatagaaaaggcgacaggcaaagaacaa
attcaacatctaatatgggtcttggttgccaaacccgatgagataataacacaatttctc
gatggcattgtctatgactataagtggattgtggaaaaaattcaaagtgaagttacaaat
catagcgaaaaaacagaattgtatttggaaaaattacgtgccatacagagcaagaatgaa
gcgcacactcagtacaatgtacatcgcacaaagccttttatggcactagggcgaaaactt
cgccttttgaatccgaaaaaaacctacaacagtgttgtgctcttgggcgatctgggcagt
ggtaaaaaatggctggcaatcgatgtgtgctccgatttcagggtcatgaaacacatgggc
tttaacatattctggattgattgtatttattgtacaaaccctgaagaggattacaatgcc
ctcaaacagctgatgttcaaattaaatcccgactttaatttcaatgagattcaatgtgcc
aatattaaagataaaatctcaacacttcaagttaaaattaaacacttgctggaatcgaaa
gaatacaaaaagtgcctgctcgtgctggccaatgtgcaaaataccaaagccgagtccgtt
ttcaaattggattgtaaacgcttgataataactcgcaatcagaaaatctatgatactctg
ccagataaagtgaatttgaaaatgaaattaaccgaaggtttgacattgatggaattccac
acgttactcgataaatatatacgaaaatataaatggcgtgaagtgaatcccgaatatgcc
agtgatatttactatgccagcaatgccgatccctatattttgagcataattgccaggcaa
ttgcaatataaacgttccaattgggatgaatggaaaaagaatttggatacattacaaata
cccgatgaaaaatttcgacgtgatatagaaaattcgttacagctattaacaccggagcaa
ttgcaattgtatgccacattatcaatatttccacattgtgccaaaataccagtcaagctt
ttggccaacctgtggcaaaaaaatctctccgatacggaaaaaatcatagaaaagctccac
agtaaatcgtttcttgaaaaggaattattgagtgatgatgataccacagtctgtagctta
cgttatatctacagttcgtacattaaaaactgtcccagcattcaaaatcttatcaatgcc
cagcaattgcatcgtgccgtaatcgattattacaaggttgaagaacatttggatatacgc
atagatgtggacttgtattttgctcccgaacatgataactatttctttcaatgtctgggc
tatcatttgtacggtgccaattatatcaaccttttccagcgcctttatatggattttgga
tttttaggacaaaaaatgcgccatgtaggtctggccaatacaattgccgatctgaaatac
tataaaaaagaaataaccttgaattgtacatcgaatatcatggacaaactgattacattc
ttggccaaagtggaggagaaacttttgcatgcgcccgactgttgtctactacaatatgcc
ttattggctaatgaagagatgatcaggcaattggcctcaaagcaaataagtcaatttcca
aggagaatgtggttcgaggaaacaggccgtttccatcagcgccgttttatacataaacta
cacagcagctgtaaaattatacgcattttggacagtgacatttgcatagtcgttctgcat
aacaatgaaacgcatctggtggatatatcgttggacactttgtgttccaatgtgcagttg
ataagggaatcgcctgtcaatattattgatattaaaccctttaacgatgccaatcacctg
ttgactcttgactcaaagggccagctgaaattgtggaaaatctatgatgaaaaacgccgc
atgattgcccagcgccgtaattcggcgagcaagtttaatctgggcgaatacaagttttgt
cgtcaacaaattgccagctgtacttttcagcagtgcataaacgatgacattatgggcttg
aggcatatagtggccttctatatggaatcgccggacaataagctgcacgtggctttggac
aatggtgacattattgtattcgattggacacatgaagaatttagaaccaatcacttctat
gtgcccttcaaaacagacattgtggacatcaagtgtatttgcaaaatcaattgcacccat
tatatgatcctacatggcagcactgaaaccccggtagatataacttttataaatttacgc
aatactggaaaggagaatataaatttcgattggccacgtgtccttaagaattttatctac
tacgaagtgtgtggcgattgcattttgatggtctatcaaaatgccatagttcgcttgagt
cccagtttttatcccggctatgtgggcggaagcatcgaggtgcttttcgaggacaataac
ttcaatatcaactgtgccaaatactcattgaaatacaactatttgatggtgggttccaat
ccgggtcttcatgttttcgatctatccaagccggtcaaagtgctggagagtattgtcagt
gagaacgtcacctccattgatatttacgatttggacgatgaggagtacaagtgtatggtt
acatgtggcatagaaaggaaaacgataatctatttactgggtctatgcaaggcagcggat
aaattggattggcagcacaaccgcgcacacagcaatcaattggtgggcgaacaacggagc
gccatacgttttaagggtaaacgtatgttcgatgttgccacatatggcggccagagctac
ctctatgccattgatagcgaaaatagaatccatcagatatcaacatccgatgcgaagaac
tggaatatccttaagatacccaatctaacactgccacaaataactgccatttgttgccaa
ggcgacaaggcttttgttgccatcaaaagccaaggtatttacgatttacatcaacacaaa
tacgtcggagaattgcaaaagtcagtagttgtaaataatcttagattaattcatggtgac
accctaatcgccacctccgactcaaacactcatataattattctaaataataatagtgga
ctttgtcagcagagaatcgactttgtggcgaaattttgctatgcgtttttggataaccat
tacatgttggtaaatgcatttggcagcattgtgttcgtagccagagatttgaagcatttc
aatattggaactgaagctttaaatggtttggccgattgcgatctaaaagctggcatggtt
ttcctgggttttaaggatttccaggtggagatttacgccctgcgcgccaatggatcaaat
gtcgagtgtaaatcactgtattcacatcaagaaagtaactgccaaataacatgtttaact
gcctcatccaatggcaaattgtttgccgtgggattgaatacatcaccacaagcccaaacc
tctgaacattgtatgatgcccaaccatgacttaaaaactgccaacaacaatacgcctgta
tcttgcggtgacatcaatgtctataaactcaacaacacagatgataagtttacggctgac
aaaatattctgcctgaaatcgcataccagtcccgttcacgatttgcatttttcaccacaa
gctgatgtacttgttagcgtgtcgggacaaatatgcttttggaacatatcttatgtactc
aacaaccccttgactgccaatactaaaaaaagacatagctctagattttcatcacaaaga
agtgccgaagaggttgatgccacccatgtgctgacccgtaatcgcaatatgaaggcggta
ttccgtagtgaaatgaaaaaatcattttgtaaaagtttgtctttgcaagcttcttcgttt
gattcggatggcaacagtgatggcgaagtcttcgaatcggaggtaaaacagatgcaacag
cagcagcaaaccgaagaaagtttttggcaatatctaacagggccagaggataaggccgaa
ttattgtcatgttataaactggatggtaacgaggccatgcagttgttcgcaaaccacgac
tttagccaattctataccatagatgacgagggcgtctattataatttaaatatcattcaa
caacccagcaaatctcccatactcaaagaagattctccagatacagttgatttgggtgat
tattcttcgagatctggcagtgaggcgtctgccgatacagagaatggtaacacactttac
aaagacatggatcgccgtttatcgttgtcatcgtctgcgtcgggccgcgatgtcgtcgac
aattaccaagcatga

DBGET integrated database retrieval system