KEGG   Musca domestica (house fly): 101889252
Entry
101889252         CDS       T03448                                 

Gene name
caspase-1
Definition
(RefSeq) caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101889252 (caspase-1)
   04215 Apoptosis - multiple species
    101889252 (caspase-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101889252 (caspase-1)
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     101889252 (caspase-1)
Peptidases and inhibitors [BR:mde01002]
 Cysteine peptidases
  Family C14: caspase family
   101889252 (caspase-1)
SSDB
Motif
Pfam: Peptidase_C14 HTH_37
Other DBs
NCBI-GeneID: 101889252
NCBI-ProteinID: NP_001295988
UniProt: B5AK94
LinkDB
AA seq 289 aa
MQQGAIAQLANKGFGTSSTSNYTARMPTDRHAVEYNMRHKNRGLAMIFNHEHFTVQSLKS
RSGTNVDCDNLARCLKQLDFDVQIYKDSTLKELMRQVEWAASQDHTNNDCILVTILSHGE
LGYIYAKDTQYKLDSIWSYFTAQRCPTSAGKPKLFFIQACQGDRLDPGVTMKRAVTQTDG
ESSMSYKIPVHADFLIAYSTIPGFYSWRNTTRGSWFMQSLCAELTANGKRYDILTLLTFV
CQRVAVDFESCTPDTPDMHQQKQIPCITTMLTRILRFSEKNQLPPAARV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcagcagggtgcaatagcccaattagcgaacaaaggtttcggtacatcgtctacatca
aattatactgccaggatgccgactgaccgtcatgcagttgagtacaatatgcgtcataaa
aaccgggggcttgccatgatttttaatcatgaacatttcactgtgcaatcactcaaatca
agatcaggcacaaacgtcgattgtgataatttggctcgatgtctcaaacaactagatttt
gatgtccagatttataaagattctacactaaaagaacttatgcgtcaggttgaatgggca
gctagccaggatcacaccaataacgattgtattttggtgaccattctttcgcacggagaa
ttgggctatatttatgctaaagatacgcagtacaaattggacagtatttggagttatttc
acagcacaacgctgtcccacatcagctggaaagccaaaattattctttattcaagcttgt
caaggtgatcgtttggaccccggtgtcactatgaaacgtgcagtgactcaaactgatggt
gagtcatcaatgagttataaaataccggtgcatgcagatttccttattgcatactcaacg
ataccagggttttactcatggcgtaatacaaccagaggatcctggtttatgcaatctttg
tgtgctgagctaactgccaacggtaaacggtacgatatacttacattgcttacgtttgtt
tgtcaacgtgttgccgttgattttgagtcatgtaccccagatacaccagatatgcaccaa
cagaagcagattccatgtataacgacgatgcttacgcgaatactacgtttttctgaaaag
aatcaattaccaccagcagcaagagtttaa

KEGG   Musca domestica (house fly): 101896713
Entry
101896713         CDS       T03448                                 

Definition
(RefSeq) caspase-3
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101896713
   04215 Apoptosis - multiple species
    101896713
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101896713
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     101896713
Peptidases and inhibitors [BR:mde01002]
 Cysteine peptidases
  Family C14: caspase family
   101896713
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 101896713
NCBI-ProteinID: XP_005185424
UniProt: A0A1I8ME07
LinkDB
Position
Unknown
AA seq 316 aa
MDESDFSVFKKSSKKKHDKADATTCNNTTAAHTADDLIPEFEKNVIVSIPTDEDEYRVDN
PHIGIALIFNHKEVKGEKQRAGTEKDRDDMQATLLKFGFDVRVYNDLTFAEVTETLKATS
KEDHSQNDCLVVVVMSHGLEGKVYARDMAYPVERLWNPFLGQNCKSLIDKPKLFFIQACR
GENLEKPVTYTRFAPMSRALDATPAKPQPVTYAIPNTADILVMYSTFEKYYSFRNVENGS
WFIQTFCEVFNHAAATTALSEKGAELLRLLTAINRLVAYDYQSNAKVEALNQMKEMPNFM
STLTKTFYLHVKKPKP
NT seq 951 nt   +upstreamnt  +downstreamnt
atggacgaatccgatttttcagttttcaaaaaatcaagcaaaaagaaacatgacaaagcc
gatgcaacaacctgcaacaacacgaccgccgcacacactgcggatgatctaataccggag
tttgagaaaaatgtcattgtctcaatacccaccgatgaagatgaatatcgcgtggataat
ccccatatcggaattgccttgattttcaatcacaaagaagtcaagggtgaaaagcagcga
gccggcaccgaaaaagatcgtgatgatatgcaggcgaccctcttgaaattcggatttgat
gttcgagtctataatgatttgacctttgcggaagttactgaaaccttaaaagcaacatcc
aaagaagatcacagtcaaaatgattgcctggtggttgtggtaatgtcgcacggtctggag
ggcaaagtatatgctcgtgatatggcatatccggtggaacgtttgtggaatccatttttg
ggtcaaaactgtaaatcattgattgataaacccaagctgttctttattcaggcttgccga
ggagagaatttggagaagcctgttacctatacacgatttgctcccatgtcacgggcactg
gatgccacaccagccaaaccccaaccggtaacctatgccataccaaatacagcggatatc
ttggttatgtattcaacgtttgaaaaatactattccttccgcaatgtggagaacggttca
tggttcatacagactttctgtgaggtatttaatcacgctgccgcaactactgctctctcc
gaaaaaggcgctgaattgctacgtcttttaaccgctatcaatcgattggtggcctacgat
tatcagtcaaatgccaaggtggaagccctgaatcaaatgaaggaaatgccaaattttatg
tcaactctgacgaaaactttctatttgcatgtcaagaaacccaagccatga

DBGET integrated database retrieval system