KEGG   Musca domestica (house fly): 101889479
Entry
101889479         CDS       T03448                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101889479
   04215 Apoptosis - multiple species
    101889479
SSDB
Motif
Pfam: Melibiase Collagen_bind_2
Other DBs
NCBI-GeneID: 101889479
NCBI-ProteinID: XP_005184304
UniProt: A0A1I8M105
LinkDB
Position
Unknown
AA seq 71 aa
MAVAFYIPDQAALMRKARQQEQQILAMREAHWRYVASVVYDVLRQYLQATPSILGRSCSS
AAQQSDKSSKK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggccgtggctttctatatacccgatcaagccgctctaatgcgtaaggcccgtcagcag
gagcaacaaattttggcaatgcgtgaggcccattggcgttatgtggcctcggtggtctat
gatgtgttaagacaatatcttcaagccactccatccatattggggcgtagctgcagcagt
gctgcccaacagtcagacaaatcatccaagaaataa

DBGET integrated database retrieval system