KEGG   Musca domestica (house fly): 101889515
Entry
101889515         CDS       T03448                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mde  Musca domestica (house fly)
Pathway
mde00230  Purine metabolism
mde01100  Metabolic pathways
mde04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101889515
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101889515
Enzymes [BR:mde01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101889515
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 101889515
NCBI-ProteinID: XP_019895729
UniProt: A0A1I8MJ11
LinkDB
Position
Unknown
AA seq 1131 aa
MTETKQQNCNIIENGHSITSIEKNRKDENESSEGPTVTLPNSVLNKLFTTFYVNQRREAL
KWFLSAYLCFSVYTIGIPADQIIQNRACYIILDVIAICSWLTMFVASRYERAKSKKPLHI
ALLIDSAPIIVFICFVIHFIIYCVNQQKTISPRELLGWSILFNFLVPVSIPVVPYMGCCM
CFITFFGYYIVIYLTSRDDPMFNEMLMANMVLVSSALIIGLIYYDMNAAKQKRAFLEAKK
SLEVKMIIEEESAEQERLLLSVLPKHVAEKMRQDLGSTSSEPFKKIYMSRHENVSILYAD
IVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDERPDHA
VLCVHMGLSMVKAIKYVQQKTNSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANK
MESSGKAGRVHISDKTLAYLNGEFEVEPAYGEKREEALRIAGLKTYFIVKVLKPFASPSA
KKINETQTNAGNNDNDDTLDEELLATDKNTDDTAKEIDETEVSDKAALFKEQLHNVLRDR
DYYAHLDQDTDFLLKFKAKESEEDYASYREPYSSLPLIAALIVQSVDIFYSFLILPRSPL
HFVNIAAPLIPIFMLVFISVAESFPGHLPDFFVSISKRYNDFTLVRELTAVIIVLTLGLS
NIIDEYFFVAYIKSEHIVTESVFNKTQSEEDFLVAEPMIDATPEPLDNIMYPSYLSNFSV
LILIATTVIAQLTHYVKIILLILITGLHWYFNIYVLNDLYSLEDDLAYNPIVPTCHVMSV
SLVLITVSLGFWARHMDREDRVIFKWKLLVSEQKERADDMRRRNEALVYNVLPVHVAEHF
MKNTKRSHDDLYSQSYSEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALL
ELPQFQDIIKIKTIGSTYMAASGINLNRDIKPGDPITKRWAHLDLLVEFALELKKTLQDI
NEQSFNHFVLKMGVNHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETC
NILQEFGYSFLQRGLVTVKGKGELMTYYLRDDMPKQTVANVSSINEATAETEIHLKMESE
TDGGGDIKTPLLQLSSENKCPSMKDISPAKACGNGEMSTEEDALINNTENL
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgacggaaaccaaacaacagaattgcaacattattgaaaatggccattccattacatcg
attgaaaagaaccgcaaggacgagaatgagtcctcggaaggacccaccgtaaccctaccg
aattcggttttaaataaattatttacaacattttatgtcaatcaaaggcgcgaagcttta
aaatggttcctttcagcatatctatgctttagtgtttatactattggtataccggctgat
caaattatacagaatagagcttgctatattatcctggatgttatagcaatatgtagctgg
ctgacaatgttcgtggccagccgttatgagagggccaaatcgaaaaagcctctgcatatt
gccctgctaatagacagtgcacccatcatagtgtttatatgctttgtaatacatttcatt
atctattgtgttaatcagcaaaagaccatatcgcccagggaattattgggctggtcaata
ttatttaattttttggttccagttagcataccggtagttccttatatgggatgttgtatg
tgttttataacattttttggttactatattgtaatctatttgacatcacgcgatgatccc
atgttcaatgaaatgttaatggcgaatatggttttagtatcgtcagctttaataataggt
ttaatctactatgacatgaatgctgcaaagcaaaagcgcgcctttttggaggccaaaaag
agtctagaagtcaaaatgatcatcgaagaagaatctgccgaacaggagcgtctgctgttg
tcagtgctgccaaagcatgtagctgagaaaatgcgtcaagatttgggttcgaccagttcg
gaaccatttaagaaaatctatatgagtcgtcatgagaatgtgagtatcctctatgctgac
atagttggcttcactgccatatcgtcgacatacagcgcccaggatttggtaaagatgtta
aacgaactgttcgctcgttttgatcgattggccgagaaataccaacaactacgtataaaa
attctgggtgactgttactattgcattagcggagccccagacgaacgaccggatcatgct
gtcctctgtgtgcacatgggtttgtcgatggttaaggcaatcaagtatgtgcaacaaaag
accaattcacctgttgatatgagagttggaatacatacgggtgctgtcttggccggtata
ttggggcaacgacaatggcaatttgatgtctattcaaaggatgttgagctggctaataaa
atggaatcaagcggaaaggctggacgtgtccacatttccgacaaaacgttggcatatttg
aatggtgaattcgaagttgagcccgcatatggagagaaacgagaagaagccctacgtatt
gctgggctgaaaacctatttcatagtcaaagtactgaaacccttcgcatcacccagcgcc
aagaaaatcaacgaaacccaaacgaatgctggcaacaacgataatgatgataccctagat
gaagagcttctcgccacggacaagaacacagatgatacagccaaagaaattgacgaaacg
gaagtatccgacaaggcagccctgtttaaggaacagctccacaatgtcttgagagatcgc
gattactatgcacacctggatcaggataccgattttctattgaaattcaaagcgaaagaa
tccgaagaggattatgcctcgtatagggaaccgtattcatcattacctctgattgccgca
ttgatagtacaaagtgttgatatattttattcatttttaatattgcccagatccccccta
cactttgtgaatatagcggcgcccttgataccaatttttatgctagttttcattagtgtg
gccgaaagttttcccggtcatttgcccgatttctttgtcagcattagcaaacgttacaat
gacttcacattggtgcgtgaattgacagctgtcataatagttttgacactaggacttagt
aatattatagatgagtacttctttgtggcctatattaaatcggagcatattgtcaccgaa
agtgtatttaacaaaacgcaaagtgaagaagatttcttggtcgcagaaccgatgattgat
gcaacaccggagccactggacaacatcatgtatccatcgtatttgagcaattttagtgta
ctcatacttatagccaccactgtaatagctcaactgacacattatgttaaaattatattg
ttaatattaataacaggtctccactggtatttcaatatatacgtgctcaacgatttatac
tccctagaagatgatttggcctataatccaatagtaccaacttgtcatgtgatgtcagta
tctctggtcctaataaccgtttcactgggcttttgggcaagacatatggatcgtgaagat
cgtgtcatattcaaatggaaacttttggtttccgaacaaaaagagagggccgatgatatg
cgtcgtcgtaatgaagctttggtctacaacgtactgccggtccatgtggctgagcatttt
atgaagaacaccaaacggtctcatgatgatttgtactcccagagttattcggaggtggga
gtactttttgccagtatgccaaatttctcggatttctattccgaagagacagtcaacaat
caaggcctagaatgtttgcgattcctcaacgaagtaatatccgatttcgatgcgctctta
gaacttccccaattccaagatataataaaaataaaaaccataggctctacatatatggca
gccagtggcatcaatttaaatcgtgatattaaacccggcgatccgataacgaaacgatgg
gcccatttggatcttttggtggaattcgccttggaactgaagaagacgctgcaagatatc
aatgaacaatcgtttaatcatttcgttctaaagatgggtgttaatcatggcccgataacg
gcgggagttattggggcccgcaagccgcactacgatatctggggaaataccgtgaatgtc
gcctcacgtatggagagtacgggaaaagctggggctattcaggtgactgaagagacttgc
aatattttgcaagaattcggttattcattccttcagcgtggtctggttacggttaagggc
aaaggcgagctaatgacatattatttaagagatgacatgcccaaacaaacagttgcaaat
gtaagtagtattaatgaagccacagcggaaacggaaattcacttgaaaatggaatcagaa
actgatggtgggggtgacataaaaacgccactactacaattgtcttcagaaaataaatgt
ccatcaatgaaagatattagtccagccaaagcctgtggcaatggcgaaatgtccacagag
gaagatgctttgataaataacacagaaaatttgtaa

DBGET integrated database retrieval system