KEGG   Musca domestica (house fly): 101889679
Entry
101889679         CDS       T03448                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 1
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
mde  Musca domestica (house fly)
Pathway
mde04120  Ubiquitin mediated proteolysis
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101889679
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101889679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101889679
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mde04121]
    101889679
Peptidases and inhibitors [BR:mde01002]
 Peptidase inhibitors
  Family I32: IAP family
   101889679
Ubiquitin system [BR:mde04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101889679
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 101889679
NCBI-ProteinID: XP_005178734
UniProt: A0A1I8M2V3
LinkDB
Position
Unknown
AA seq 456 aa
MKMSGNVATEIWASQPQLWLVPFPSNLLKHIPSNPTPAALASVPNQDETDNNTHNEFLQI
GQLKPRYAMDDRFHREDERLKTYENWPLNFLDPNELARSGMFYMGESDKTKCYFCEVEIG
RWEREDQPVPEHLRWSPNCPLLRRRTTNNVPINAELLERTLPAPSYDICGANDIEIRRNA
FAEGTIPAPLMSDVPPGSPVVMAAGSSSAGGGSAMTTGGTFFPEVPEYAIETARIRSFAE
WPRNMKQKPEQLAEAGFFYTGVGDRVKCFSCGGGLKDWDDDDEPWEQHALWMNKCRFVKL
MKGDAFIEAVANKFMKNKPAASNNRTPTPTSESSLSSSEEEGEPAVHLAEGNQETTHTTV
AGSAATKVSSASIPKPCSNEQAPATTAVAGVNALEQKRSSSTIPEEKLCKICYANEYNTA
FLPCGHVVACAKCASSVTKCPMCRKPFADVMRVYFS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaaaatgtctggaaatgtagcaaccgaaatatgggcctcacagccacagctatggttg
gtaccattcccaagtaatttattgaaacatataccatccaatccgacaccagcagcatta
gcaagtgtcccaaatcaggacgaaacggataataatacacataacgagtttctacaaatt
ggccaattaaagccacgttatgccatggacgatagattccatcgtgaagatgaacgcctc
aagacgtacgaaaattggccattgaatttcttggatcccaacgaattggcccgttcgggc
atgttctatatgggcgaatcggataaaaccaaatgctatttctgtgaggtggaaattggc
cggtgggaacgtgaagatcaacctgtacctgaacatctgcgctggtcgcccaattgcccc
ttgctgaggaggcgcactaccaacaatgtgcccatcaatgctgaactcttagagcgtacc
ttacccgcccccagttatgatatttgcggagcgaatgacattgaaatcagacgaaatgca
tttgctgaaggcaccatcccagcaccactaatgtccgatgtaccacctggctcaccagtg
gttatggcggccggcagcagtagcgctggtggtggcagtgcaatgacaactggaggtaca
tttttccctgaggtgcccgaatatgccatcgagacagcccgtatacgatcctttgccgaa
tggccacgaaacatgaaacaaaaacctgaacagttggccgaggccggttttttctatact
ggtgtgggcgatcgtgtcaagtgcttcagttgtggcggtggtcttaaggactgggacgat
gatgatgaaccctgggaacagcatgccttgtggatgaataaatgtcgttttgtaaaattg
atgaaaggcgatgcattcattgaagctgtggcaaataaattcatgaaaaataaaccagct
gcaagcaacaacagaactcctacaccaacgtcggaatcgtctctctcctcgtcggaagaa
gagggggagcctgcagtgcatttggcggagggaaatcaagaaacaacacatacaacggtc
gccggttccgctgcaacaaaagtatcatccgcttcaattcccaagccttgttccaacgaa
caggcacccgccacaactgctgtcgccggtgtcaatgccttggaacagaaaaggtcgagc
tccacaatacccgaggagaaattgtgcaaaatctgctatgccaacgaatacaatacagcg
tttttaccctgtggccacgttgtggcctgtgccaagtgcgcctcgtctgttacaaaatgt
ccaatgtgtcggaaaccttttgccgatgttatgagggtttatttctcttaa

DBGET integrated database retrieval system