KEGG   Musca domestica (house fly): 101889856
Entry
101889856         CDS       T03448                                 

Definition
(RefSeq) cytochrome c-2
  KO
K08738  cytochrome c
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101889856
   04215 Apoptosis - multiple species
    101889856
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 101889856
NCBI-ProteinID: XP_005179805
UniProt: T1PF88
LinkDB
Position
Unknown
AA seq 108 aa
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTDANKSK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPGDRADLIAYLKSATA
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggtgttccagctggtgatgttgaaaagggcaagaaactcttcgtccaacgttgtgct
caatgccacactgtcgaagctggcggtaaacacaaagtaggccccaatttgcatggtttg
ttcggccgcaagactggtcaagccgctggattcgcctacacagatgccaacaaatccaag
ggcatcacctggaatgaagataccttgttcgaatacttggaaaaccccaagaaatacatc
ccaggcacaaagatgatctttgctggtttgaagaagcctggagatcgcgctgacctcatt
gcctacctgaaatccgctaccgcttaa

KEGG   Musca domestica (house fly): 101898295
Entry
101898295         CDS       T03448                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101898295
   04215 Apoptosis - multiple species
    101898295
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 101898295
NCBI-ProteinID: XP_005177584
UniProt: A0A1I8N8V4
LinkDB
Position
Unknown
AA seq 108 aa
MGVPAGDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggagtacctgctggcgatgttgaaaagggcaaaaaaatttttgtccagcgttgcgcc
caatgccacactgtggaagctggaggaaaacataaggtgggtccaaatttgcatggtcta
tttggtcgcaagaccggccaggctgctggtttcgcctacacagatgccaacaaagccaag
ggcattacatggaacgaagacaccttgtttgagtatctagaaaacccaaagaaatatatc
ccaggcacaaagatgatatttgccggtctaaagaaacccaatgaacgcggagatctcatt
gcttatcttaaatctgccaccaagtaa

DBGET integrated database retrieval system