KEGG   Musca domestica (house fly): 101889977Help
Entry
101889977         CDS       T03448                                 

Definition
(RefSeq) glucose transporter type 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mde02000]
    101889977
Transporters [BR:mde02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   101889977
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    101889977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 BLOC1_2 DUF1664 Syntaxin-6_N Baculo_PEP_C NPV_P10 T2SSF
Motif
Other DBs
NCBI-GeneID: 101889977
NCBI-ProteinID: XP_019891679
LinkDB All DBs
Position
Unknown
AA seq 1742 aa AA seqDB search
MAHSVDISMISPPTSSSISNDQDPFGQLPPLLPPLRSTQVLQPLTVFPVSNLSEDSYDYV
FGGRRKTPPSTTALKLTSPPVRLRPEDAYTNTRNSGSGGFASSNTNNGTTAGRLYRHSFS
YVPKRSRHSQNERERNANYESRLRCHGEDEATLRQLLLDLQKQVSVMSMNLSAKLDELQR
GDRHLETTVALCEIRTQLQELTKSVESCQSEVSEVKRDMVAIKHELDTVQQVKEEIEELR
EYVDRLEEHTHRRKLRLLEQGLTFFLTYSIFSAVLGMLQFGYNTGVINAPEKNIENFMKD
VYKDRFGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGITG
GCLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTV
GLLLSQVLGIEQILGTNDGWPILLGLAVCPAVLQLILLPVCPESPRYLLITKQWEEEARK
ALRRLRASSTVDEDIEEMRAEERAQQSESHISTMELICSPTLRAPLIIGIVMQLSQQFSG
INAVFYYSTSLFVSSGLSEESAKFATIGIGAIMVAMTLVSIPLMDRTGRRTLHLYGLGGM
FIFSIFITISFLIKEMIDWMSYLSVVSTLGFVVFFAVGPGSIPWMITAELFSQGPRPSAM
AIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEIL
ALFRHGNGRSTQNFTNSSEPQSMNSGIEHAALMVSEEKTQHDSLRNDSLPETASVHSTSV
EPTQQQQQPQHQSQSKLQKQHSGEQPQQQKQQADQHHHHHVHCSYEKDIVCDESQMHQHH
QQPQQPQQPTSKQHSEHWQQSNTNTATTTTCTADYSLPFNASDSQTPQQQQQHRHQHMPR
KQSAHGHSHSPHPSRHTSPHSRHTSPHSRHTSPHSRHTSPHSRHTSPHSRHTSPHSRHTS
PHSRHTSPHGAGGHGHSHSHGHSHSSPHQSTHHHLHDQHQQNGHDAPEPFVRNSALRASV
RSTSSHMHARHHSHHHHRRRKPLTNGAGNNDADIQQHHHDGPTHSALRTQTHTTHTCTRR
HRSVTDLSNASLNTCNDPTCTDREVQEIFVHKSAACCSGSRPELAQYFAEDLYGTSSRRP
SSCCTSSDYCYQTDSTSLYGSRSSLSRNNSVKSASVTLRKKKISQQRQPSYHSISLRALN
AESRPDSNMGSLASIFDRAKQYAETGEKLHGSASKVTIERQTSKDALSNDLPEYACSPSP
IRWSFLADGKNDKDAGDSTQSKAETAERNGAKSKPPEHKRAADKQQQQQQHSSSSQQYHY
QQPIKPERGRKDHRTAGQPQKPPRSQSQHRKSIASDDVRPSTSSRKCCDSPCKYEESTMV
QFHQDAEAFNNCCSNYIQCNTYLDQDLQITSEDIHHYLAKGQQDVGNILNNTKTYPFQPS
NALEFQYKNNFANNNTATNTLSSVEGAESMRSYDSRYRRNSSKETNLNQNTSTSESCAGG
AGCPSANFNQQPLSAANINLSSSTNNINIVFSTSTERNTNEVKFINTTSRTATSMMTSDS
SYLPYSYPTYDYTNMSANSTFDKPLGIDEIPANMNRGDEANGGNTSSSQHSSSLHSPEPR
GVSFESFDAASGHNLISSHRGSCQYSPTTPRSPISPGSPACSSTYSASINPSTTSYVHLQ
QHHPHYDYPPGIQRSHVHSHTHSHHSHHHLHDHHLRESFKISNALKKVRKRARKYTDFLR
KK
NT seq 5229 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatagcgttgatatatcgatgatctcgccaccaacatcgtcttccatatccaac
gatcaggatccatttggacaattgccaccgctgttaccgccactgcgttcaacacaagtc
ttacaacctttaacggtatttccagtgtccaatttgagtgaagattcatatgactatgtg
tttggtggtcgacgcaagactccgccttctacaacagcacttaagttgacctcgcctcca
gtaagattgagaccagaggacgcctatacaaatacacgcaacagtggtagtggtggtttc
gctagttcaaatacaaataacggtactacagctggtcgtctttatcgtcattccttcagt
tatgtaccaaaacgttctcgtcactcacaaaacgaacgtgaacggaatgcaaattacgaa
tcgagattaagatgtcatggcgaagatgaagcaaccctgcggcaactgctacttgatttg
caaaagcaagttagcgtgatgagcatgaatctttcggctaaattagatgagcttcagaga
ggcgatcgtcacttggagacaacagtcgccttgtgtgaaatacgaacacagctacaggaa
ttaaccaaatccgtggaaagttgtcaaagtgaagtgtccgaggttaagcgtgacatggtt
gcgatcaaacacgaactggacacagtacaacaagtcaaagaggaaatcgaggagctacgc
gaatatgttgacagattggaagagcacacgcacagaaggaagctaagacttttagaacaa
ggtcttacctttttcctaacatactcaatattttcggcggtattgggtatgttacagttc
ggttacaataccggtgtgataaatgcgcccgaaaagaatatcgaaaactttatgaaggat
gtgtacaaagatcgttttggcgaagatatcagcgaagaatttatacaacagctgtactcg
gtggcagtgtcaatatttgccatcggtggtatgctgggcggtttcagtggcggttggatg
gcgaatcgcttcggaagaaagggtggtttattattaaataatgttttgggtataactggt
ggctgtttaatgggttttaccaaagttagtcattcctatgaaatgttattccttggccgt
tttataattggtgttaattgcggtctcaatacatcattagtgccaatgtacatttccgaa
attgcccctctgaatttaagaggcggcctaggtactgttaatcaattggctgtgactgta
ggtttactattatcccaagtattgggtattgaacaaattttaggaaccaatgatggctgg
cctattctattgggcctggccgtgtgtcctgcagttttacaattaatcttactgccggta
tgtccagaatctcctagatatctgttaattaccaaacaatgggaggaagaagctagaaaa
gcactcagacgtttacgtgcctcaagtaccgtcgatgaagacatcgaagaaatgcgtgcc
gaagagcgtgcccaacaatccgaaagtcatatatccacaatggaactgatatgttcgccc
acactcagagcccctctgatcattggcattgtcatgcagctatcgcaacaattcagtggt
atcaatgctgttttctattactcaacatcactgttcgttagttcggggctatcggaagaa
agcgccaaatttgcgacaataggcattggtgctatcatggtggcgatgacattagtttct
atacctctgatggatcgaaccggtcgccgtactcttcacctgtatggcttgggtggcatg
ttcatattctcgatatttataacaatatcgtttttaataaaggaaatgatcgattggatg
tcctatctgtcggtggtatccacactgggctttgtcgtcttctttgcggtgggtcccggc
tcaataccctggatgataacggccgaactattttcccaaggcccccggcccagtgccatg
gccatagcggtgttggtaaattggatggccaattttgtggttggcattggattccccagt
atgaagactgctttggaaaactatacattcttaccgtttagtgtattcttagccatattt
tggatattcacctacaagaaggttcctgagaccaaaaataagacattcgaagagattttg
gctctcttccgtcatggaaatggaaggagtacgcaaaacttcacaaatagttcggagcca
caaagcatgaattcgggcatcgaacatgccgccctcatggtgtctgaggagaaaacccaa
catgattcactgaggaacgactcacttcctgaaactgccagtgtacattcaacgagcgtt
gaaccaacccaacaacaacaacaaccacaacaccagtcgcaatctaaactacaaaaacag
cattccggagaacagccacaacaacaaaaacagcaagccgatcaacaccaccaccatcac
gtacactgtagctatgaaaaagatattgtatgtgatgagtctcaaatgcaccagcaccat
cagcagccgcaacaaccgcaacagccgacatcaaagcagcacagcgagcactggcaacaa
agcaacaccaacactgcgaccaccaccacttgcaccgccgactattcactgccgtttaat
gcaagcgattcgcaaacaccgcaacaacaacaacagcatcgccaccaacacatgccacga
aaacaatctgcgcatggacacagtcacagtccacatccaagtcgtcatacctccccgcac
agtcgtcacacatctccacacagccggcatacatcaccccatagccgacacacttcacct
catagccgtcatacttcaccacatagccgtcacacctctccacatagccgtcatacctct
ccacacagtcgccacacctcaccccatggtgctggaggacatggtcatagccacagtcat
ggacattctcattcctcaccacatcaatcaactcatcatcacctgcatgatcaacaccaa
caaaatggccacgatgcaccggaaccatttgtacgcaacagtgctctgagagcctcggtg
aggagtacctcttcccacatgcatgcccgtcatcactcccatcaccaccatcgcaggcgt
aaaccacttacgaatggagcgggcaataacgatgcagacatccagcagcatcatcacgat
ggcccaacacactccgctcttcgcactcagacgcacacaacacacacatgcacccgtcgc
catcgctcggtaaccgacctatccaatgcatcgctaaacacctgtaacgatccgacctgc
actgatcgtgaggttcaagaaattttcgtacacaaatccgcagcctgttgctcgggttca
aggcctgagttagctcaatattttgccgaggatttgtatggcacctcatcgcgccggcca
tcgtcctgctgcacttcttccgactattgctaccaaaccgattcaaccagtctctatggt
tcgcgttcctccctgagtcgcaacaattccgtcaaatcggcctcggtcactctgcgaaag
aagaaaataagccaacagcgtcaacccagctatcactcaatctcgctgcgggccctcaat
gccgagtcacggcctgacagtaatatgggctccttagcctccatattcgatcgtgccaaa
caatatgccgagactggtgagaaactacacggctccgcttccaaggtaactatagaaaga
caaacttcgaaagatgctttaagtaatgacctacctgaatatgcttgttctccctccccg
ataaggtggagtttcctggctgatggcaaaaatgacaaagacgctggcgactcgacccaa
tcgaaagccgaaaccgctgagagaaatggagccaaatcaaagccgcccgaacataaacgg
gctgctgataagcagcagcagcagcaacaacactcctcctcgtcccagcaatatcactat
caacagcccatcaagccagaacgaggccgcaaggaccaccggacggctggacaaccccag
aaaccgccaagatctcaatctcagcatcgtaaatccatagcctccgacgatgtcaggcca
tcgacatcatcgcgaaaatgttgtgacagtccttgcaagtacgaagagtcgaccatggtc
cagttccatcaggatgctgaggccttcaacaactgttgcagcaattacatacaatgcaac
acgtacttggatcaggatctgcaaatcaccagtgaggatatccatcactatctggccaag
ggtcaacaggatgttggaaatatattgaacaataccaagacgtatcccttccagccgagc
aatgccttggagttccaatacaagaataattttgccaataacaacactgccaccaacacc
ttgtcttcggtggagggggccgaaagcatgcgcagctatgacagtcgttatcgccgcaac
tccagtaaggagacaaatcttaatcaaaacacatccacatctgagagttgtgcaggtgga
gcaggttgtccctcggcaaacttcaaccagcaacccttgtcggcggccaacatcaactta
tcttcgagcacaaataatataaatatcgttttcagtacctccacagagcgcaataccaat
gaggtgaagttcatcaataccacgtcgcgcactgctacttcaatgatgacatcggatagc
tcttatctgccatacagttatccaacgtacgactacaccaacatgtcggccaactcaacg
ttcgacaaacccttgggcatcgatgaaatacccgcaaacatgaatcggggtgatgaagcc
aacggcggtaatacatcgtccagtcagcactcctcatcgttgcattcgcccgaaccacga
ggcgtgtcatttgaatcattcgatgctgcttcgggtcacaatttgatttcatcacatcgc
ggcagttgccagtattcacccacaacaccacgctcacccatatcgcccggttcgccagct
tgctcctccacctattcggcttcgataaatccttcgacaacatcctatgtacatttgcag
cagcatcatcctcactatgactatccgccgggcattcagcggtcgcatgtccactctcac
acgcattcacatcactcgcatcatcatctacacgatcatcatttgcgtgaaagtttcaag
ataagcaatgctttgaagaaagtgcgcaagcgggcacgtaaatataccgactttttgcgt
aagaaatga

DBGET integrated database retrieval system